KEGG   Homo sapiens (human): 9824
Entry
9824              CDS       T01001                                 
Symbol
ARHGAP11A, GAP_(1-12)
Name
(RefSeq) Rho GTPase activating protein 11A
  KO
K20635  Rho GTPase-activating protein 11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9824 (ARHGAP11A)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    9824 (ARHGAP11A)
SSDB
Motif
Pfam: RhoGAP
Other DBs
NCBI-GeneID: 9824
NCBI-ProteinID: NP_055598
OMIM: 610589
HGNC: 15783
Ensembl: ENSG00000198826
Pharos: Q6P4F7(Tdark)
UniProt: Q6P4F7
Structure
Position
15:32615144..32639941
AA seq 1023 aa
MWDQRLVRLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVP
EYGHIPSFLVDACTSLEDHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKATLLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNTEKKLRLQAAVVQTLIDYASDIGR
VPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPN
RTPSITPQEERIAQLSESPVILTPNAKRTLPVDSSHGFSSKKRKSIKHNFNFELLPSNLF
NSSSTPVSVHIDTSSEGSSQSSLSPVLIGGNHLITAGVPRRSKRIAGKKVCRVESGKAGC
FSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTG
LLFSPDVDEKLPKKGSEKISKSEETLLTPERLVGTNYRMSWTGPNNSSFQEVDANEASSM
VENLEVENSLEPDIMVEKSPATSCELTPSNLNNKHNSNITSSPLSGDENNMTKETLVKVQ
KAFSESGSNLHALMNQRQSSVTNVGKVKLTEPSYLEDSPEENLFETNDLTIVESKEKYEH
HTGKGEKCFSERDFSPLQTQTFNRETTIKCYSTQMKMEHEKDIHSNMPKDYLSKQEFSSD
EEIKKQQSPKDKLNNKLKENENMMEGNLPKCAAHSKDEARSSFSQQSTCVVTNLSKPRPM
RIAKQQSLETCEKTVSESSQMTEHRKVSDHIQWFNKLSLNEPNRIKVKSPLKFQRTPVRQ
SVRRINSLLEYSRQPTGHKLASLGDTASPLVKSVSCDGALSSCIESASKDSSVSCIKSGP
KEQKSMSCEESNIGAISKSSMELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKV
PLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKP
VDL
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgtgggatcagaggctggtgaggttggccctgttgcagcatctgcgggccttctatggt
attaaggtgaagggtgtccgtgggcagtgcgatcgcaggagacatgaaacagcagccacg
gaaatagggggtaaaatatttggagtaccttttaatgcactgccccattctgctgtacca
gaatatggacacattccaagctttcttgtcgatgcttgcacatctttagaagaccatatt
cataccgaagggctttttcggaaatcaggatctgtgattcgcctaaaagcactaaagaat
aaagtggatcatggtgaaggttgcctatcttctgcacctccttgtgatattgcgggactt
cttaagcagttttttagggaactgccagagcccattctcccagctgatttgcatgaagca
cttttgaaagctcaacagttaggcacagaggaaaagaataaagctacactgttgctctcc
tgtcttctggctgaccacacagttcatgtattaagatacttctttaactttctcaggaat
gtttctcttagatccagtgagaataagatggacagcagcaatcttgcagtaatatttgca
ccgaatcttcttcagacaagtgaaggacatgaaaagatgtcttctaacacagaaaagaag
ctacgattacaggctgcagtagtacagactcttatcgattatgcatcagatattgggcgt
gtaccagattttatcctggaaaagataccagccatgttgggtattgatggtctctgtgct
actccatcactggaaggctttgaagaaggtgaatatgaaactcctggtgaatataagaga
aagagaagacaaagtgtaggagattttgttagtggagcactaaataaatttaaacctaac
agaacaccttctattacacctcaagaagaaagaattgcccagctatctgaatcaccagtg
attcttacaccaaatgctaagcgtacattgccagtagattcttctcatggtttctcaagt
aagaaaaggaagtccatcaagcacaattttaactttgagctgttgccaagtaatctcttc
aatagcagttctacaccggtatcagttcacatcgatacaagctcagaagggtcatctcag
agttcactctctcctgtactcattggtggaaaccatttgatcactgcaggtgtgccaagg
cgaagtaaaagaattgcaggcaaaaaagtttgcagagtggaatcaggaaaagcaggctgc
ttttctcctaaaatcagccataaagaaaaggttcgaagatctctgcgtttgaaattcaat
ctagggaaaaatggcagagaagtaaatggatgttctggtgtcaatagatatgaaagtgtt
ggttggcgacttgcaaatcaacaaagtttaaaaaatcgaattgaatctgtaaaaacaggt
ttgctttttagcccagatgttgatgaaaagttaccaaagaaaggttcagaaaagatcagt
aagtctgaggaaaccttactaactccagagcgactagttggaacaaattaccggatgtct
tggacaggacctaataattcaagttttcaagaagtagatgcaaatgaagcttcttcaatg
gtggaaaatcttgaggtagaaaactctttggagcctgatattatggtagaaaagtcacct
gctacttcatgtgaactcaccccttccaatttaaacaataagcataatagcaacataaca
agtagccctcttagcggggatgaaaataacatgaccaaagagactttggtgaaagttcaa
aaagcgttttctgaatctggaagtaatcttcacgcattgatgaatcagaggcagtcatca
gtaactaatgtggggaaagtaaaattaactgaaccatcttatttagaagatagcccagag
gaaaatctatttgaaactaatgatttgactatagtagaatcaaaggagaaatatgaacac
cacactggtaaaggtgaaaaatgtttttcagagagggacttttcaccccttcaaactcaa
acatttaatagagaaacaactataaaatgttattcaactcagatgaagatggaacatgaa
aaagacattcattcaaatatgccaaaagattatttaagcaagcaagaattctccagtgat
gaagaaataaagaaacagcagtccccaaaggataaactaaataataaattaaaagagaat
gagaatatgatggaaggtaacttaccgaagtgtgcagcacatagcaaggacgaggctaga
tcctctttctcacagcagagtacatgtgttgtaacaaacttgtcaaaacctaggcctatg
agaattgctaaacagcagtcattggaaacatgtgagaaaacagtttctgaaagttcacaa
atgacagaacatagaaaggtttctgatcacatacagtggtttaacaagctttctttaaat
gaaccaaatagaataaaagtcaagtcacctcttaagtttcagcgtactcctgttcgtcag
tccgtcagaagaattaattctttgttggagtatagcagacaacctacagggcataagttg
gcgagtcttggtgatacagcttctcctttggtcaaatcagtgagctgtgacggtgctctt
tcctcttgtatagaaagtgcatcaaaagattcctctgtttcatgtatcaaatcaggtcct
aaagaacagaagtccatgtcatgtgaagagtcaaatattggtgcaatttcaaagtcaagc
atggagttaccctcgaaatctttcttaaagatgaggaagcacccagattcagtgaatgct
tctcttaggtctactacagtttataaacagaagatcttatctgatggccaagttaaggtt
cccttggatgatctgactaatcatgatatagtaaaaccagttgtaaataacaacatgggc
atttcttctgggataaataacagggtccttaggagaccatcagaaagaggaagggcctgg
tacaaaggttctccaaaacatcctatcggaaaaactcaattactaccaacaagtaaacct
gtagatttgtaa

DBGET integrated database retrieval system