KEGG   Homo sapiens (human): 983Help
Entry
983               CDS       T01001                                 

Gene name
CDK1, CDC2, CDC28A, P34CDC2
Definition
(RefSeq) cyclin dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa04540  Gap junction
hsa04914  Progesterone-mediated oocyte maturation
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06230  Cell cycle G1/S
  Element
N00455  CDC25-Cell cycle G2/M
N00456  HIV Vpr to CDC25-cell cycle G2M
N00457  HIV Vpr to cell cycle G2M
N00458  HIV Vpr to CDC25-cell cycle G2M
N00459  WEE1-Cell cycle G2/M
N00460  HIV Vpr to WEE1-cell cycle G2M
N00499  ATR-p21-Cell cycle G2/M
Drug target
Alvocidib (DG02041): D02880 D09868
Dinaciclib: D09604
Zotiraciclib: D11599
Zotiraciclib citrate: D11600
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    983 (CDK1)
   04114 Oocyte meiosis
    983 (CDK1)
   04115 p53 signaling pathway
    983 (CDK1)
   04218 Cellular senescence
    983 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    983 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    983 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    983 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    983 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    983 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    983 (CDK1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    983 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    983 (CDK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     983 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     983 (CDK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   983 (CDK1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    983 (CDK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    983 (CDK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   983 (CDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Kdo Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 983
NCBI-ProteinID: NP_001307847
OMIM: 116940
HGNC: 1722
Ensembl: ENSG00000170312
Vega: OTTHUMG00000018290
Pharos: P06493(Tchem)
UniProt: P06493
Structure
PDB: 

Position
10q21.2
AA seq 297 aa AA seqDB search
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaggaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatcttt
gagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatg
gattcttcacttgttaagagttatttataccaaatcctacaggggattgtgttttgtcac
tctagaagagttcttcacagagacttaaaacctcaaaatctcttgattgatgacaaagga
acaattaaactggctgattttggccttgccagagcttttggaatacctatcagagtatat
acacatgaggtagtaacactctggtacagatctccagaagtattgctggggtcagctcgt
tactcaactccagttgacatttggagtataggcaccatatttgctgaactagcaactaag
aaaccacttttccatggggattcagaaattgatcaactcttcaggattttcagagctttg
ggcactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaaatggaaaccaggaagcctagcatcccatgtcaaaaacttggatgaaaatggc
ttggatttgctctcgaaaatgttaatctatgatccagccaaacgaatttctggcaaaatg
gcactgaatcatccatattttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system