KEGG   Homo sapiens (human): 9830Help
Entry
9830              CDS       T01001                                 

Gene name
TRIM14
Definition
(RefSeq) tripartite motif containing 14
  KO
K12004  tripartite motif-containing protein 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9830 (TRIM14)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    9830 (TRIM14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY zf-B_box PRY DUF3919
Motif
Other DBs
NCBI-GeneID: 9830
NCBI-ProteinID: NP_055603
OMIM: 606556
HGNC: 16283
Ensembl: ENSG00000106785
Vega: OTTHUMG00000020339
Pharos: Q14142(Tdark)
UniProt: Q14142 A0A024R165
Position
9q22.33
AA seq 442 aa AA seqDB search
MAGAATGSRTPGRSELVEGCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGL
ALEAAVHVQKLSQECLKQLAIKKQQHIDNITQIEDATEKLKANAESSKTWLKGKFTELRL
LLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRVWSISQEPDPVQRLQA
YTATEQEMQQQMSLGELCHPVPLSFEPVKSFFKGLVEAVESTLQTPLDIRLKESINCQLS
DPSSTKPGTLLKTSPSPERSLLLKYARTPTLDPDTMHARLRLSADRLTVRCGLLGSLGPV
PVLRFDALWQVLARDCFATGRHYWEVDVQEAGAGWWVGAAYASLRRRGASAAARLGCNRQ
SWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT
FQEPLYPALRLWEGAISIPRLP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcggcgaccgggagccggacccctgggaggtcggagcttgtcgagggatgc
ggctggcgctgcccggagcatggcgaccgcgtggctgagctcttctgtcgccgctgccgc
cgctgcgtgtgcgcgctttgcccggtgctgggcgcgcaccgtggccaccctgtgggcctg
gcgctggaggcagcggtgcacgtgcagaaactcagccaagaatgtttaaagcagctggca
atcaagaagcagcagcacattgacaacataacccagatagaagatgccaccgagaagctc
aaggctaatgcagagtcaagtaaaacctggctgaaggggaaattcactgaactcagatta
ctacttgacgaagaggaagcgctggccaagaaattcattgataaaaacacgcagcttacc
ctccaggtgtacagggaacaagctgactcttgcagagagcaacttgacatcatgaatgat
ctctccaacagggtctggagtatcagccaggagcccgatcctgtccagaggcttcaggca
tacacggccaccgagcaggagatgcagcagcagatgagcctcggggagctgtgccatccc
gtgcccctctcctttgagcccgtcaagagcttctttaagggcctcgtggaagccgtggag
agtacattacagacgccattggacattcgccttaaggaaagcataaactgccagctctca
gacccttccagcaccaagccaggtaccttgttgaaaaccagcccctcaccagagcgatcg
ctattgctgaaatacgcgcgcacgcccacgctggatcctgacacgatgcacgcgcgcctg
cgcctgtccgccgatcgcctgacggtgcgctgcggcctgctgggcagcctggggcccgtg
cccgtgctgcggttcgacgcgctctggcaagtgctggctcgtgactgcttcgccaccggc
cgccactactgggaggttgacgtgcaggaggcgggcgccggctggtgggtgggcgcggcc
tacgcctcccttcggcgccgcggggcctcggccgccgcccgcctgggctgcaaccgccag
tcctggtgcctcaagcgctacgaccttgagtactgggccttccacgacggccagcgcagc
cgcctgcggccccgcgacgacctcgaccggctcggcgtcttcctggactacgaggccggc
gtcctcgccttctacgacgtgacgggcggcatgagccacctgcataccttccgcgccacg
ttccaggagccgctctacccggccctgcggctctgggagggggccatcagcatcccccgg
ctgccctag

DBGET integrated database retrieval system