KEGG   Homo sapiens (human): 9837
Entry
9837              CDS       T01001                                 

Gene name
GINS1, IMD55, PSF1
Definition
(RefSeq) GINS complex subunit 1
  KO
K10732  GINS complex subunit 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    9837 (GINS1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    9837 (GINS1)
SSDB
Motif
Pfam: Sld5
Other DBs
NCBI-GeneID: 9837
NCBI-ProteinID: NP_066545
OMIM: 610608
HGNC: 28980
Ensembl: ENSG00000101003
Vega: OTTHUMG00000032124
Pharos: Q14691(Tbio)
UniProt: Q14691
Structure
PDB: 
2E9X 2Q9Q 2EHO

Position
20p11.21
AA seq 196 aa
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIP
TIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRS
LATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
KCEQLIRQGVLEHILS
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttctgcgaaaaagccatggaactgatccgcgagctgcatcgcgcgcccgaagggcaa
ctgcctgccttcaacgaggatggactcagacaagttctggaggagatgaaagctttgtat
gaacaaaaccagtctgatgtgaatgaagcaaagtcaggtggacgaagtgatttgatacca
actatcaaatttcgacactgttctctgttaagaaatcgacgctgcactgtagcatacctg
tatgaccgcttgcttcggatcagagcactcagatgggaatatggtagcgtcttgccaaat
gcattacgatttcacatggctgctgaagaaatggagtggtttaataattataaaagatct
cttgctacttatatgaggtcactgggaggagatgaaggtttggacattacacaggatatg
aaaccaccaaaaagcctatatattgaagtccggtgtctaaaagactatggagaatttgaa
gttgatgatggcacttcagtcctattaaaaaaaaatagccagcactttttacctcgatgg
aaatgtgagcagctgatcagacaaggagtcctggagcacatcctgtcatga

DBGET integrated database retrieval system