KEGG   Homo sapiens (human): 984Help
Entry
984               CDS       T01001                                 

Gene name
CDK11B, CDC2L1, CDK11, CDK11-p110, CDK11-p46, CDK11-p58, CLK-1, PITSLREA, PK58, p58, p58CDC2L1, p58CLK-1
Definition
(RefSeq) cyclin dependent kinase 11B
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    984 (CDK11B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    984 (CDK11B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     984 (CDK11B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   984 (CDK11B)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    984 (CDK11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 984
NCBI-ProteinID: NP_001778
OMIM: 176873
HGNC: 1729
Ensembl: ENSG00000248333
Vega: OTTHUMG00000078638
Pharos: P21127(Tbio)
UniProt: P21127
Position
1p36.33
AA seq 795 aa AA seqDB search
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGK
HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERK
MREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPR
ERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESG
SGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED
EERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQ
ELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPI
TSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVK
TLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVT
LWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEK
IWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKH
EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTT
NQGASAAGPGFSLKF
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgaaaaggactcttggaaagtgaaaactttagatgaaattcttcaggaaaag
aaacgaaggaaggaacaagaggagaaagcagagataaaacgcttaaaaaattctgatgac
cgggattccaagcgggattcccttgaggagggggagctgagagatcaccgcatggagatc
acaataaggaactccccgtatagaagagaagactctatggaagacagaggagaagaagat
gattctttggccatcaaaccaccccagcaaatgtctcggaaagaaaaagctcatcacaga
aaagatgaaaagagaaaagagaaacgtaggcatcgtagccattcagcagaaggggggaag
catgctagagtgaaagaaaaagaaagagagcacgaacgtcggaaacggcatcgagaagaa
caggataaagctcgccgggaatgggaaagacagaagagaagggagatggcaagggagcat
tccaggagagaaagggaccgcttggagcagttagaaaggaagcgggagcgggagcgcaag
atgcgggagcagcagaaggagcagcgggagcagaaggagcgcgagcggcgggcagaggag
cggcgcaaggagcgggaggcccgcagggaagtgtctgcacatcaccgaacgatgagagag
gactacagcgacaaagtgaaagccagccactggagtcgcagcccgcctcggccgccgcgg
gagcggttcgagttgggagacggccggaagccaggtgaggccaggccggcgcctgcgcag
aagccagcacagttaaaagaagagaaaatggaagaaagggacctgctgtccgacttacag
gacatcagcgacagcgagaggaagaccagctcggccgagtcctcgtcagcggaatcaggc
tcaggttctgaggaagaagaggaggaggaggaagaggaggaggaggaagggagcaccagt
gaagaatcagaggaggaggaggaggaagaggaagaggaggaggaggagaccggcagcaac
tctgaggaggcatcagagcagtctgccgaagaagtaagtgaggaagaaatgagtgaagat
gaagaacgagaaaatgaaaaccacctcttggttgttccagagtcacggttcgaccgagat
tccggggagagtgaagaagcagaggaagaagtgggtgagggaacgccgcagagcagcgcc
ctgacagagggcgactatgtgcccgactcccctgccctgtcgcccatcgagctcaagcag
gagctgcccaagtacctgccggccctgcagggctgccggagcgtcgaggagttccagtgc
ctgaacaggatcgaggagggcacctatggagtggtctacagagcaaaagacaagaaaaca
gatgaaattgtggctctaaagcggctgaagatggagaaggagaaggagggcttcccgatc
acgtcgctgagggagatcaacaccatcctcaaggcccagcatcccaacatcgtcaccgtt
agagagattgtggtgggcagcaacatggacaagatctacatcgtgatgaactatgtggag
cacgacctcaagagcctgatggagaccatgaaacagcccttcctgccaggggaggtgaag
accctgatgatccagctgctgcgtggggtgaaacacctgcacgacaactggatcctgcac
cgtgacctcaagacgtccaacctgctgctgagccacgccggcatcctcaaggtgggtgac
ttcgggctggcgcgggagtacggatcccctctgaaggcctacaccccggtcgtggtgacc
ctgtggtaccgcgccccagagctgctgcttggtgccaaggaatactccacggccgtggac
atgtggtcagtgggttgcatcttcggggagctgctgactcagaagcctctgttccccggg
aagtcagaaatcgatcagatcaacaaggtgttcaaggatctggggacccctagtgagaaa
atctggcccggctacagcgagctcccagcagtcaagaagatgaccttcagcgagcacccc
tacaacaacctccgcaagcgcttcggggctctgctctcagaccagggcttcgacctcatg
aacaagttcctgacctacttccccgggaggaggatcagcgctgaggacggcctcaagcat
gagtatttccgcgagacccccctccccatcgacccctccatgttccccacgtggcccgcc
aagagcgagcagcagcgtgtgaagcggggcaccagcccgaggccccctgagggaggcctg
ggctacagccagctgggtgacgacgacctgaaggagacgggcttccaccttaccaccacg
aaccagggggcctctgccgcgggccccggcttcagcctcaagttctga

DBGET integrated database retrieval system