KEGG   Homo sapiens (human): 9841
Entry
9841              CDS       T01001                                 
Symbol
ZBTB24, BIF1, ICF2, PATZ2, ZNF450
Name
(RefSeq) zinc finger and BTB domain containing 24
  KO
K10503  zinc finger and BTB domain-containing protein 24
Organism
hsa  Homo sapiens (human)
Disease
H02308  Immunodeficiency-centromeric instability-facial anomalies syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9841 (ZBTB24)
   04121 Ubiquitin system [BR:hsa04121]
    9841 (ZBTB24)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    9841 (ZBTB24)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9841 (ZBTB24)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-met zf-C2H2_6 zf_UBZ Zn-ribbon_8 zf-Di19 HypA zf-C2HE zinc_ribbon_15 AT_hook DUF2180 zf-C2HC_2 DUF6011 zf_C2H2_10 zf-AN1
Other DBs
NCBI-GeneID: 9841
NCBI-ProteinID: NP_055612
OMIM: 614064
HGNC: 21143
Ensembl: ENSG00000112365
Pharos: O43167(Tbio)
UniProt: O43167
Position
6:complement(109462594..109483219)
AA seq 697 aa
MAETSPEPSGQLVVHSDAHSDTVLASFEDQRKKGFLCDITLIVENVHFRAHKALLAASSE
YFSMMFAEEGEIGQSIYMLEGMVADTFGILLEFIYTGYLHASEKSTEQILATAQFLKVYD
LVKAYTDFQNNHSSPKPTTLNTAGAPVVVISNKKNDPPKRKRGRPKKVNTLQEEKSELAA
EEEIQLRVNNSVQNRQNFVVKGDSGVLNEQIAAKEKEESEPTCEPSREEEMPVEKDENYD
PKTEDGQASQSRYSKRRIWRSVKLKDYKLVGDQEDHGSAKRICGRRKRPGGPEARCKDCG
KVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVCSKALT
TKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHYRVHTGHSLPECKDCHRKFMDVSQ
LKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGKSFSDSSAKRRH
CILHTGKKPFSCPECNLQFARLDNLKAHLKIHSKEKHASDASSISGSSNTEEVRNILQLQ
PYQLSTSGEQEIQLLVTDSVHNINFMPGPSQGISIVTAESSQNMTADQAANLTLLTQQPE
QLQNLILSAQQEQTEHIQSLNMIESQMGPSQTEPVHVITLSKETLEHLHAHQEQTEELHL
ATSTSDPAQHLQLTQEPGPPPPTHHVPQPTPLGQEQS
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcagaaacatcgccagagccttctgggcagcttgttgtacactcagacgctcacagt
gacactgtgctggccagttttgaggatcagaggaagaaaggcttcctctgtgacattact
ttaatcgtggagaatgtacatttccgggcccacaaagccttacttgctgccagtagtgaa
tacttctcaatgatgtttgcagaagagggggaaatcggccaatccatttatatgctggaa
ggcatggttgcagacacctttggtatcctgctggaatttatctacacaggttatctccat
gccagtgagaaaagtacagaacaaatcctggctactgctcagttcttaaaagtctatgac
ctggtaaaggcttacacagacttccaaaataatcatagctccccaaagccaacaactttg
aacactgctggtgccccagtggttgttatctctaataagaaaaacgatcctccaaagcgg
aaacggggaagaccaaaaaaagtcaatacattgcaggaggagaaatcagaactggctgca
gaggaagaaatacagttaagagtgaacaattcagttcagaatagacaaaactttgtggtt
aaaggagacagtggtgtactgaatgagcaaattgcagcaaaagaaaaggaagaatcggag
cctacttgtgagccaagtagagaggaggaaatgccagttgaaaaagatgagaactatgat
cccaagaccgaggatggccaggcaagccagagtcgatacagcaagcggaggatttggaga
tccgtcaaacttaaagattacaaacttgttggggatcaagaggaccatggttcagccaag
aggatctgtggaaggagaaagcgccctggaggccctgaggcccgctgtaaagactgtggc
aaggtctttaagtacaatcactttttagcaatccaccagaggagccacacaggggagcga
cctttcaaatgtaatgagtgtggaaaaggctttgcccagaagcactcgctacaggtccac
accaggatgcacacaggcgagcggccgtacacctgcaccgtgtgcagcaaggctctgacc
accaagcactcactgctggagcacatgagcctgcactcaggacagaagtcttttacctgt
gatcaatgcggaaaatatttcagccagaacagacagctaaagagccattaccgagttcat
acaggccactcattaccggaatgcaaagactgccatcgcaaattcatggatgtgtctcag
ctaaagaaacatctgcgaacacacacaggtgagaagccatttacttgtgaaatctgtggc
aaatctttcacagcaaagagttctcttcagacccacatcagaatccatcgaggagaaaag
ccatactcctgtggcatttgtggcaaatccttctctgactccagtgccaaaaggagacac
tgcattctacacactggcaagaagcctttctcctgccctgagtgtaacttacagtttgct
cgcttagacaacttgaaggctcacttgaaaattcatagcaaggagaagcatgcttcagat
gccagcagcatttctggcagtagtaatacagaagaggtcaggaatattcttcagctacag
ccatatcaactctctacctcgggagagcaggaaattcagcttctcgtaaccgattctgta
cataacatcaatttcatgcccggtcctagccagggaatcagcattgtgactgcagagagt
tcccaaaacatgactgcagaccaggctgctaatcttaccctgctcacgcagcagccagag
caactgcagaatttaattctttcagctcaacaggagcaaacagaacacattcagagcctc
aatatgattgaaagccagatggggccctcacaaacagagccagtgcacgtgatcactctg
tccaaggaaacactggaacatcttcatgcccatcaagagcaaacagaggagctccattta
gctacaagtacttcagatccagctcagcacctgcagctgacacaggagcctggtccgcca
ccacccactcaccacgtgccccagccaacgccacttggccaggagcagagctga

DBGET integrated database retrieval system