KEGG   Homo sapiens (human): 9844Help
Entry
9844              CDS       T01001                                 

Gene name
ELMO1, CED-12, CED12, ELMO-1
Definition
(RefSeq) engulfment and cell motility 1
  KO
K12366  engulfment and cell motility protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    9844 (ELMO1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05131 Shigellosis
    9844 (ELMO1)
   05100 Bacterial invasion of epithelial cells
    9844 (ELMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3361 ELMO_CED12 PH_12 FERM_N ZFYVE21_C
Motif
Other DBs
NCBI-GeneID: 9844
NCBI-ProteinID: NP_001193409
OMIM: 606420
HGNC: 16286
Ensembl: ENSG00000155849
Vega: OTTHUMG00000023701
Pharos: Q92556(Tbio)
UniProt: Q92556 A4D1X5
Structure
PDB: 

Position
7p14.2-p14.1
AA seq 727 aa AA seqDB search
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgccgccacccgcggacatcgtcaaggtggccatagaatggccgggcgcctaccccaaa
ctcatggaaattgatcagaaaaaaccactgtctgcaataataaaggaagtctgtgatggg
tggtctcttgccaaccatgaatattttgcactccagcatgccgatagttcaaacttctat
atcacagaaaagaaccgcaatgagataaaaaatggcactatccttcgattaaccacatct
ccagctcagaacgcccagcagctccatgaacgaatccagtcctcgagtatggatgccaag
ctggaagccctgaaggacttggccagcctctcccgggatgtcacgtttgcccaggagttt
ataaacctggacggtatctctctcctcacgcagatggtggagagcggcactgagcgatac
cagaaattgcagaagatcatgaagccttgctttggagacatgctgtccttcaccctgacg
gccttcgttgagctgatggaccatggcatagtgtcctgggatacattttcggtggcgttc
attaagaagatagcaagttttgtgaacaagtcagccatagacatctcgatcctgcagcgg
tccttggccattttggagtcgatggtgctcaatagccatgacctctaccagaaagtggcg
caggagatcaccatcggccagctcattccacacctgcaagggtcagatcaagaaatccaa
acctatactattgcagtgattaatgcgcttttcctgaaggctcctgatgagaggaggcag
gagatggcgaatattttggctcagaagcaactgcgttccatcattttaacacatgtcatc
cgagcccagcgggccatcaacaatgagatggcgcaccagctgtatgttctacaagtgctc
acctttaacctcctggaagacaggatgatgaccaaaatggacccccaggaccaggctcag
agggacatcatatttgaacttcgaagaattgcttttgatgctgagtctgaacctaacaac
agcagtggcagcatggagaaacgcaagtccatgtacacgcgagattataagaagcttggg
ttcattaatcatgtcaaccctgccatggacttcacgcagactccacctgggatgttggct
ctggacaacatgctgtactttgccaagcaccaccaagatgcctacatccggattgtgctt
gagaacagtagtcgagaagacaagcatgaatgtccctttggccgcagtagtatagagctg
accaagatgctatgtgagatcttgaaagtgggcgagttgcctagtgagacctgcaacgac
ttccacccgatgttcttcacccacgacagatcctttgaggagtttttctgcatctgtatc
cagctcctgaacaagacatggaaggaaatgagggcaacttctgaagacttcaacaaggta
atgcaggtggtgaaggagcaggttatgagagcacttacaaccaagcctagctccctggac
cagttcaagagcaaactgcagaacctgagctacactgagatcctgaaaatccgccagtcc
gagaggatgaaccaggaagatttccagtcccgcccgattttggaactaaaggagaagatt
cagccagaaatcttagagctgatcaaacagcaacgcctgaaccgccttgtggaagggacc
tgctttaggaaactcaatgcccggcggaggcaagacaagttttggtattgtcggctttcg
ccaaatcacaaagtcctgcattacggagacttagaagagagtcctcagggagaagtgccc
cacgattccttgcaggacaaactgccggtggcagatatcaaagccgtggtgacgggaaag
gactgccctcatatgaaagagaaaggtgcccttaaacaaaacaaggaggtgcttgaactc
gctttctccatcttgtatgactcaaactgccaactgaacttcatcgctcctgacaagcat
gagtactgtatctggacggatggactgaatgcgctactcgggaaggacatgatgagcgac
ctgacgcggaatgacctggacaccctgctcagcatggaaatcaagctccgcctcctggac
ctggaaaacatccagatccctgacgcacctccgccgattcccaaggagcccagcaactat
gacttcgtctatgactgtaactga

DBGET integrated database retrieval system