KEGG   Homo sapiens (human): 9846Help
Entry
9846              CDS       T01001                                 

Gene name
GAB2
Definition
(RefSeq) GRB2 associated binding protein 2
  KO
K08091  growth factor receptor bound protein 2-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04380  Osteoclast differentiation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    9846 (GAB2)
   04072 Phospholipase D signaling pathway
    9846 (GAB2)
   04071 Sphingolipid signaling pathway
    9846 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    9846 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    9846 (GAB2)
  09158 Development
   04380 Osteoclast differentiation
    9846 (GAB2)
 09160 Human Diseases
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    9846 (GAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_3 PH_9 PH_2 PH_8
Motif
Other DBs
NCBI-GeneID: 9846
NCBI-ProteinID: NP_536739
OMIM: 606203
HGNC: 14458
Ensembl: ENSG00000033327
Vega: OTTHUMG00000166673
Pharos: Q9UQC2(Tbio)
UniProt: Q9UQC2
Position
11q14.1
AA seq 676 aa AA seqDB search
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcggcgacgtggtgtgcaccggctggctgaggaaatcgcctcccgagaag
aagttgaggcgctatgcctggaagaaacgctggtttatcctgcggagtggccggatgagc
ggtgacccagatgttctggaatactacaagaacgatcactccaagaagcctctgcggatc
atcaacctgaacttctgtgagcaggtagatgcaggcctgacctttaacaagaaggagctg
caggatagttttgtgtttgacatcaagaccagtgaacgcaccttttacctggtggctgag
acagaagaggacatgaataagtgggtccagagcatctgccagatctgtggcttcaatcag
gctgaggagagcacagactccctgagaaatgtttcctcagccggtcatggcccccgctct
tctccagctgagctcagcagctctagccagcaccttctccgagagcgcaagtcctcagcc
ccatcacactccagccagccaactctgttcacgtttgaaccccctgtgtcaaaccacatg
cagcccaccttgtccaccagcgcacctcaggagtatctctacttgcaccagtgcataagc
cgaagagcagaaaatgcaaggagtgccagcttctctcagggcaccagagcctcttttctc
atgaggagtgacacagctgtacaaaaacttgcccagggcaatggacactgtgtcaacggg
atcagtggtcaagtccatggcttctatagccttcccaagccgagccggcacaatacagaa
ttcagagacagtacctacgacctcccccgcagcctggcctcccatggccacaccaagggc
agcctcacaggctccgagacagataatgaggatgtgtacaccttcaagacgcccagcaac
accctgtgcagggagttcggggacctcctggtagacaatatggatgttccggccacccca
ctctcagcctaccagatccctaggacattcactctggacaaaaaccacaatgccatgaca
gtggccactcctggggactcagccatagctcccccaccccgcccccccaagccaagtcag
gcagaaacacctcgatggggcagtcctcagcagagaccgccaatcagtgaaaatagcaga
tctgtcgctgccaccatccccagacgcaacaccctccctgcaatggacaacagccgactt
caccgagcttcttcctgtgagacctacgagtacccacagcgtggtggagagagtgcaggc
cggtctgctgaatccatgagtgatggagttggctctttcctgccagggaaaatgattgtg
ggccgatcggacagcaccaattctgaagacaactatgtgcccatgaatccaggttcttcc
accctgttggccatggaacgagcaggtgataattcccagagcgtctacatcccaatgagc
ccaggggcccatcactttgactcacttggctacccatcaacaacccttcctgtgcaccga
ggccccagcagaggaagtgagattcagccaccccctgtcaaccgcaacctcaaacctgat
cggaaagcaaagccaacaccacttgacctgaggaacaacaccgtcatcgatgaactcccc
ttcaagtcacctatcaccaagtcttggtctagggccaaccacaccttcaactccagctcc
tcccagtactgccgccccatctccacccagagcatcaccagcacagactcaggagacagc
gaagagaactatgtccctatgcaaaacccagtgtctgcatctcccgttcccagtggcacg
aacagtcctgcccctaagaagagcaccggcagcgttgattatctggccctggacttccag
ccgagctccccaagcccccaccgcaagccatctacttcatccgtcacctctgatgagaag
gtggactacgttcaggtggacaaggagaagacccaggccctgcagaacaccatgcaggag
tggacagacgtgcggcagtcctcagagccttccaagggtgccaagctgtga

DBGET integrated database retrieval system