KEGG   Homo sapiens (human): 9847
Entry
9847              CDS       T01001                                 
Symbol
C2CD5, CDP138, KIAA0528
Name
(RefSeq) C2 calcium dependent domain containing 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: C2 YbjQ_1
Other DBs
NCBI-GeneID: 9847
NCBI-ProteinID: NP_055617
OMIM: 618044
HGNC: 29062
Ensembl: ENSG00000111731
Pharos: Q86YS7(Tbio)
UniProt: Q86YS7
Position
12:complement(22448583..22544542)
AA seq 1000 aa
MPGKLKVKIVAGRHLPVMDRASDLTDAFVEVKFGNTTFKTDVYLKSLNPQWNSEWFKFEV
DDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLYSEAATVISGWFPIYDTIHGIRG
EINVVVKVDLFNDLNRFRQSSCGVKFFCTTSIPKCYRAVIIHGFVEELVVNEDPEYQWID
RIRTPRASNEARQRLISLMSGELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIG
TACTLDKLSSPAAFLPACNSPSKEMKEIPFNEDPNPNTHSSGPSTPLKNQTYSFSPSKSY
SRQSSSSDTDLSLTPKTGMGSGSAGKEGGPFKALLRQQTQSALEQREFPFFTLTAFPPGF
LVHVGGVVSARSVKLLDRIHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSI
CEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFCHIPYDELNMPFPAHL
TYCYNCRKQKVPDVLFTTIDLPTDATVIGKGCLIQARLCRLKKKAQAEANATAISNLLPF
MEYEVHTQLMNKLKLKGMNALFGLRIQITVGENMLMGLASATGVYLAALPTPGGIQIAGK
TPNDGSYEQHISHMQKKINDTIAKNKELYEINPPEISEEIIGSPIPEPRQRSRLLRSQSE
SSDEVTELDLSHGKKDAFVLEIDDTDAMEDVHSLLTDVPPPSGFYSCNTEIMPGINNWTS
EIQMFTSVRVIRLSSLNLTNQALNKNFNDLCENLLKSLYFKLRSMIPCCLCHVNFTVSLP
EDELIQVTVTAVAITFDKNQALQTTKTPVEKSLQRASTDNEELLQFPLELCSDSLPSHPF
PPAKAMTVEKASPVGDGNFRNRSAPPCANSTVGVVKMTPLSFIPGAKITKYLGIINMFFI
RETTSLREEGGVSGFLHAFIAEVFAMVRAHVAALGGNAVVSYIMKQCVFMENPNKNQAQC
LINVSGDAVVFVRESDLEVVSSQQPTTNCQSSCTEGEVTT
NT seq 3003 nt   +upstreamnt  +downstreamnt
atgccagggaagctgaaggtgaaaatcgtggccgggcgccatttgccagtgatggaccgt
gctagtgacctgactgatgccttcgtggaggtaaaatttggtaataccacctttaaaaca
gatgtgtaccttaagtcactcaaccctcagtggaactcggagtggtttaaatttgaggtg
gatgatgaagacttacaagatgaacctttacagatcacagttcttgaccatgatacttac
agtgcaaatgatgccattggtaaagtgtacattgatattgatcctttactgtatagtgaa
gctgcaacagtcatctcaggatggtttccaatttatgacaccatacatggtatccgtggg
gaaatcaatgtagttgtcaaagtagacctcttcaatgatttaaatcgatttaggcagtca
tcatgtggagtcaaattcttttgcacaacgtctattccaaaatgctatagagctgtgata
attcatggatttgtagaagaacttgtggtcaatgaagacccagaatatcagtggattgat
cgaattcgcacaccaagggcatcaaatgaggccagacagagactcatttcgttaatgtca
ggtgagctgcagaggaagattggcttgaaagtacttgaaatgagaggaaatgcagttgtg
gggtacttacagtgtttcgatctggagggcgagtctgggttagtggtgcgagccatagga
acggcgtgtactctggataaattaagtagcccagcagcattccttcctgcatgtaattcc
ccatccaaagaaatgaaggagattcccttcaatgaagatcccaatcccaatactcactca
tcaggaccctcaacccctctgaaaaaccaaacttattccttttcaccttccaagtcctac
agtcgacagtcctcttcttctgacacagatttgagtttgacacccaaaactggaatggga
agtggtagtgctggaaaagaaggggggccctttaaagctcttttaagacaacagactcaa
tcagcgttggaacagagggaatttccattttttaccttgacggcatttcctcctggattc
cttgtacacgttgggggtgtagttagtgcacgttctgtgaagcttttggatcgtatccac
aatcctgatgaaccagaaactcgagatgcatggtgggcagaaatcagacaagaaataaaa
tcacatgctaaagcattaggctgtcatgctgtagtgggctacagtgaatcaactagcatc
tgtgaagaggtctgcattttatctgcatctggcacagcggctgtactgaatcctagattt
ctgcaggatggcaccgtggaaggctgtttggaacagaggcttgaagaaaatttgcctaca
cgttgtggattttgtcatataccatatgatgaactgaatatgccatttccagctcatctc
acatattgctataactgcaggaaacaaaaagttcctgatgttctgtttacaactatagac
ctcccaacagatgcaacagttattggaaaaggttgtcttattcaagcaaggttatgtcgc
ttaaaaaagaaagcacaggcagaagcaaatgctacagctatcagtaatctcttgccattt
atggaatatgaagtgcatactcagctaatgaataaactaaaactcaaaggaatgaatgct
ttgtttggactaagaattcagatcacagtgggtgaaaatatgttgatgggcttagcgtct
gccacaggtgtgtatttagcagctttaccaactcctggtggtattcagattgctgggaag
actcctaatgatggctcatatgaacaacacatctctcatatgcagaagaagataaatgac
acaattgctaaaaacaaagagttatatgaaatcaatcctccagagatatctgaagagatt
ataggatcacccatcccagaacctaggcaacgctcaagacttctaagatctcaatcagaa
agctcggatgaagttacagaattagacctttcacatgggaaaaaagatgcttttgttttg
gagattgatgacacagatgccatggaagatgtccattctctacttactgatgttcctcct
ccttcaggcttttatagttgtaatacagaaattatgcccggtataaataattggacctct
gaaatacagatgttcacttcagtaagagtaatcagattaagcagcctcaacctgactaat
caagctctcaataagaactttaatgatctctgtgaaaatttgctcaagagcctgtacttt
aaactacgatctatgatcccctgctgcctttgccatgtaaattttacagtatctctgcct
gaagatgaattaattcaggttacagtcacggcagtcgcaatcacttttgacaaaaatcag
gctttacaaaccacaaaaacccctgttgaaaagtcattgcaaagagcctcaacagataat
gaagaacttttacaatttccactggaactgtgttcagattcacttccttctcatcctttt
ccaccagctaaagccatgacagttgaaaaagcaagtccagtgggtgatggaaatttccgg
aatcgttctgctccaccttgtgcaaattccacagttggggttgttaagatgacacctctt
tcttttattcctggagcaaaaataactaagtatcttgggataattaacatgttttttatt
cgagagactacttctcttcgggaggaaggaggagtcagtggttttctccatgcttttatt
gctgaagtgtttgcaatggtgagagctcatgttgctgcattaggagggaatgctgttgtc
tcctacataatgaagcagtgtgtcttcatggagaatccaaataaaaaccaggcacagtgt
cttataaatgtaagtggtgatgcagtggtttttgttcgtgaatctgacttagaagtggtg
tcatctcagcaacctactaccaactgccagtcatcatgtactgaaggcgaagttacaacc
tga

DBGET integrated database retrieval system