KEGG   Homo sapiens (human): 9863Help
Entry
9863              CDS       T01001                                 

Gene name
MAGI2, ACVRIP1, AIP-1, AIP1, ARIP1, MAGI-2, NPHS15, SSCAM
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
Network
N00342  MAGI-PTEN signaling pathway
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9863 (MAGI2)
   04151 PI3K-Akt signaling pathway
    9863 (MAGI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ MAGI_u1 PDZ_2 WW MAGI_u5 Guanylate_kin
Motif
Other DBs
NCBI-GeneID: 9863
NCBI-ProteinID: NP_036433
OMIM: 606382
HGNC: 18957
Ensembl: ENSG00000187391
Vega: OTTHUMG00000130697
Pharos: Q86UL8(Tbio)
UniProt: Q86UL8
Structure
PDB: 

Position
7q21.11
AA seq 1455 aa AA seqDB search
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEE
PDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPS
SEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQP
QDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGE
STRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASP
QRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRR
EGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSD
KLPSVLKPGASAASR
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccatgagagtgtcatt
ggcaggaacccggagggccagctgggctttgaactgaaggggggcgccgagaatggacag
ttcccctacctgggggaggtgaagcccggcaaggtggcctatgagagcggcagcaaattg
gtgtcggaggagctgctgctggaggtgaacgagacccccgtggcggggctcaccatcagg
gacgtgctggccgtgatcaaacactgcaaggaccccctccggctcaagtgtgtcaagcaa
ggaggaattgttgataaagaccttcgtcactacctcaacttacgatttcaaaagggttct
gtggaccatgagcttcagcaaatcattcgtgacaacctctacctccgcacggtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggattatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtgggacttatgaagac
aattactacggtaccccaaagccgccagcagaaccagcaccattattgttaaatgtaaca
gaccagatacttccaggagccactccaagtgctgaaggaaaacggaagaggaataaatca
gtgagcaacatggagaaagccagtatagagcctcctgaggaggaagaggaagagaggcct
gtggtcaatggaaatggagtagtagtaacaccagaatccagtgaacatgaagacaaaagt
gcaggtgcctcaggggagatgccctcccagccttatcctgcaccagtgtacagtcagcct
gaggagctgaaggagcagatggatgacacaaagccaactaaacctgaagacaatgaggaa
ccagacccattgcctgataactgggaaatggcctatacagagaagggcgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaa
cctccagaagagtgcaaagaaaatgagcttccatatggctgggaaaaaatcgatgatccc
atttatggcacttattatgttgaccacataaatagaagaacacagtttgaaaatcctgtc
ctggaagcaaaaaggaagctacagcaacataacatgccccacacagaacttggaacaaag
cccctgcaggccccaggtttccgagaaaaaccactcttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctaaaaaagagcaacatgggctttggatttaccatc
attggtggagacgagcctgatgagtttctgcaggtgaaaagtgtgattccggatgggcct
gcagcacaggatggaaaaatggaaacaggtgatgtcattgtctatattaatgaagtttgt
gtccttggacacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcag
agtgtcaacctggtgttgtgtcgtggctaccctttgccctttgatcctgaagaccctgct
aacagcatggtgccaccccttgcaataatggagaggccacctccagtgatggtcaatgga
agacacaactatgaaacatatttggagtacatttctcggacctcacagtcagttccagat
ataacagatcggccgcctcattctctgcactccatgccaactgatggtcagctagacggc
acgtatccaccgcccgtccatgatgacaatgtgtctatggcttcatctggggccacccaa
gctgaacttatgaccttaaccattgtgaaaggtgcccagggcttcggcttcactattgcc
gacagtcctacaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctg
tgtgaaggcgacctcattgttgagatcaaccagcagaatgtacagaacctgagccataca
gaagtagtggatatacttaaggactgtcccattggaagtgaaacttctttgattatccat
cgaggaggtttcttttctccatggaaaactccaaagcctataatggaccgatgggagaat
caaggcagtcctcaaacgagtttatctgctccggccataccgcagaacctgcccttccca
cctgcccttcacaggagctcctttcctgactcaacagaggcctttgacccacggaagcct
gatccatatgagctctacgagaaatctagggccatttatgaaagtaggcaacaagtgcca
cccaggaccagttttcgaatggattcctctggtccagattataaggaattggatgttcat
cttcggaggatggagtctggatttggcttcagaatcctcgggggagatgagcctggacag
cctattttgattggagctgtcattgccatgggctcagccgacagagatggccgccttcac
ccaggagatgagcttgtgtatgttgatgggattccagtagccggcaaaacccaccgctat
gtcatcgacctcatgcaccacgcagcccgcaatgggcaggtcaacctcactgtgagaaga
aaggtgctatgtggaggggagccctgcccagagaacgggagaagtccaggctctgtatcc
acccaccacagctctccacgcagtgactacgcaacctacaccaacagcaaccacgctgcc
cccagtagcaatgcctctccccctgaaggcttcgcctcccacagcctgcagaccagtgat
gtggtcattcaccgcaaagagaatgagggcttcggctttgtcatcatcagctccctgaac
aggcctgagtctggatccactataactgtgccccataaaatcggacgcatcattgatggg
agtcctgcagatcgctgtgcaaaactaaaagtgggagaccggatcctagcagtgaatggc
cagtctatcatcaacatgcctcacgctgacatcgtgaagctcatcaaggatgcaggtctt
agtgtcacccttcgcatcattcctcaggaggagctcaacagccccacctcggcacccagc
tcagagaagcagagtcccatggcgcagcagagtcccctggcacagcagagtcccctggcc
cagccaagcccagccacccccaacagccccatcgcccagccagcaccacctcaaccactt
cagctgcaaggacacgaaaatagttacaggtcggaagtgaaagcaaggcaagatgtgaaa
ccagacatccgacagcctccattcacagactacaggcagcccccgctggattacaggcaa
cccccaggaggggactaccagcagcccccacccttggactacaggcagcctcccctactg
gactacaggcagcactcccccgacaccaggcagtaccctctgtcggactacagacaaccc
caggattttgattatttcactgtggacatggagaaaggagccaaaggatttggattcagc
attcgtggaggaagggaatacaaaatggatttgtatgtgttgagactggcagaagatgga
ccagcaataaggaatgggaggatgagggtaggagatcaaatcattgaaatcaatggggaa
agcacaagggacatgacacatgccagagcaatagaactcatcaaatctggaggaagacga
gtgaggctgctgctcaagagaggcacgggacaggtcccagaatatgacgaacccgccccc
tggagttctcccgctgccgccgccccaggtctgccggaagtaggcgtctccctggacgac
ggcctcgctccattctctccatcacatccagccccaccctccgacccttcccaccagata
agcccaggcccaacttgggatatcaaacgggaacacgacgttaggaaaccaaaggagctt
tcagcctgcggccagaagaagcagcgcctcggggagcagagggagcgctcggcgagtccg
cagagggccgcgcggccgaggctcgaggaggcgcccggcggccaggggcggcccgaggcc
ggcaggcccgcctcggaggccagggcgcccgggctcgcggcggcagacgcggcggacgcg
gcgcgggcgggcgggaaggaggcgccccgtgcggcggcgggctccgagctctgccggcgc
gaaggcccgggggctgcgccggcgtttgccggcccgggcggcggcggcagcggcgcgctg
gaggccgagggcagggcgggtgcgcgcgcgggtccccggccgggcccgcgacccccgggg
ggcgccccggcgcgcaaggccgccgtcgcgccggggccctggaaggtgccgggttctgac
aagctgcccagcgtcctcaaacccggcgcctcggccgccagcagatga

DBGET integrated database retrieval system