KEGG   Homo sapiens (human): 9874Help
Entry
9874              CDS       T01001                                 

Gene name
TLK1, PKU-beta
Definition
(RefSeq) tousled like kinase 1
  KO
K08864  tousled-like kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9874 (TLK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9874 (TLK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  TLK family
   9874 (TLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 9874
NCBI-ProteinID: NP_036422
OMIM: 608438
HGNC: 11841
Ensembl: ENSG00000198586
Vega: OTTHUMG00000132243
Pharos: Q9UKI8(Tchem)
UniProt: Q9UKI8
Position
2q31.1
AA seq 766 aa AA seqDB search
MSVQSSSGSLEGPPSWSQLSTSPTPGSAAAARSLLNHTPPSGRPREGAMDELHSLDPRRQ
ELLEARFTGVASGSTGSTGSCSVGAKASTNNESSNHSFGSLGSLSDKESETPEKKQSESS
RGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTP
SSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRID
DLLRANCDLRRQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSSREKSMQDRLRL
GHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVNQQREDIERQRKLLAKRKPPTANNSQAP
STNSEPKQRKNKAVNGAENDPFVRPNLPQLLTLAEYHEQEEIFKLRLGHLKKEEAEIQAE
LERLERVRNLHIRELKRINNEDNSQFKDHPTLNERYLLLHLLGRGGFSEVYKAFDLYEQR
YAAVKIHQLNKSWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDTFCTVLEY
CEGNDLDFYLKQHKLMSEKEARSIVMQIVNALRYLNEIKPPIIHYDLKPGNILLVDGTAC
GEIKITDFGLSKIMDDDSYGVDGMDLTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSV
GVIFFQCLYGRKPFGHNQSQQDILQENTILKATEVQFPVKPVVSSEAKAFIRRCLAYRKE
DRFDVHQLANDPYLLPHMRRSNSSGNLHMAGLTASPTPPSSSIITY
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtccaaagtagcagtggaagtttggaggggccgccatcttggtcccagctctcc
acgtctccaaccccgggctcggcggcggcggccaggtccctgctgaatcacacgccgcca
tccgggaggcccagggaaggtgcaatggatgagcttcatagtctggatccaagaaggcaa
gagttattggaagctagatttactggagttgcaagtgggagcactggaagtacgggcagt
tgcagtgttggagctaaagcctcaacaaataacgaaagctctaatcacagttttggaagc
ttgggatctttaagtgacaaagaatcagagacaccggagaagaaacaatcggaatcatcc
aggggaagaaagagaaaagcagaaaaccagaatgaaagtagtcagggaaaaagtattggg
ggacgtggccacaaaattagcgactattttgaataccagggtggaaatggctcaagtcca
gtaagaggcatacctcctgcaatccgttctcctcaaaattcacattcacattccactcct
tcctcatctgttcgaccgaatagcccttctcctactgcattagcatttggggaccaccct
attgtacaaccaaagcaattatcctttaaaattattcagactgatctcacaatgctgaaa
ttagcagcattagaaagtaataaaatccaggacctggaaaagaaggagggacgtatagat
gatttgctcagggctaactgtgatctcagacggcaaatagatgaacaacaaaaattactt
gaaaaatacaaagaacgattaaataagtgcatatcaatgagcaagaaacttcttattgaa
aagagtacacaagaaaagctgtcaagcagagagaagagtatgcaagatcgattacgcctc
gggcactttacaacagttagacatggcgcttcatttactgaacaatggacagatggtttt
gcatttcagaatcttgtgaagcaacaagaatgggtgaatcagcaaagggaagatattgaa
aggcaaaggaaacttctagccaaacgcaaacctcccacagctaataattctcaggcaccc
tctaccaattctgaaccaaaacaaaggaaaaacaaagcagtcaatggagcagagaatgat
ccctttgttagaccaaatttaccacaactgttgactttggcagaatatcatgaacaggaa
gaaattttcaaacttagactaggacatctcaaaaaggaagaggcagaaatccaggcagaa
cttgaacgtttggaaagagtcagaaatcttcacatacgtgagctgaaaagaataaacaat
gaagataattcacagttcaaagatcacccaacattaaatgaaagatatttattacttcat
ctgcttggtagaggtggctttagtgaagtgtataaggcttttgacctttatgaacaaaga
tatgctgctgtgaagatacatcagcttaataaaagctggagagatgagaagaaagaaaac
taccacaaacatgcctgcagagagtatagaatacacaaagaactggatcaccccagaata
gttaaactctatgattatttctccttggatacagatacgttttgtacagtgttagaatac
tgtgaaggcaatgacttggatttctatctgaagcaacacaagttaatgtcagagaaagaa
gctcggtctattgtaatgcagattgtaaatgcactaagatatctcaatgagatcaaaccc
cctattatacattatgatcttaagccaggaaacatcctactggtagatggaacagcatgt
ggtgaaatcaaaatcactgattttggtctgtccaagattatggatgatgatagctatggt
gtagatggaatggatctaacttcccagggggcaggcacttactggtatttacctcctgag
tgttttgtagttggaaaagagccaccaaagatttccaacaaggttgatgtatggtcggtt
ggagtcatcttctttcagtgtctttatggtagaaagccatttggtcacaatcaatctcaa
caagacattcttcaagaaaatacaatattaaaagccacagaagtccagttccctgtaaaa
ccggttgtaagcagtgaagccaaggcatttataagacgctgtttggcatatcgaaaagaa
gatcgatttgatgtgcaccagctggcaaatgacccataccttctcccacacatgagaaga
tcaaattcttcaggaaacctacacatggctgggctgacagcatcccctacacccccttct
tcaagcataattacttactga

DBGET integrated database retrieval system