KEGG   Homo sapiens (human): 988Help
Entry
988               CDS       T01001                                 

Gene name
CDC5L, CDC5, CDC5-LIKE, CEF1, PCDC5RP, dJ319D22.1
Definition
(RefSeq) cell division cycle 5 like
  KO
K12860  pre-mRNA-splicing factor CDC5/CEF1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    988 (CDC5L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    988 (CDC5L)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    988 (CDC5L)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    988 (CDC5L)
 Complex C
   Prp19-CDC5 complex
    988 (CDC5L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    988 (CDC5L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_Cef Myb_DNA-binding Myb_DNA-bind_6 Rap1_C
Motif
Other DBs
NCBI-GeneID: 988
NCBI-ProteinID: NP_001244
OMIM: 602868
HGNC: 1743
Ensembl: ENSG00000096401
Vega: OTTHUMG00000014767
Pharos: Q99459(Tbio)
UniProt: Q99459
Structure
PDB: 

Position
6p21.1
AA seq 802 aa AA seqDB search
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKSKF
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaattatgatcaaggggggcgtatggaggaataccgaggatgaaattctgaaa
gcagcggtaatgaaatatgggaaaaatcagtggtctaggattgcctcattgctgcataga
aaatcagcaaagcagtgcaaagccagatggtatgaatggctggatccaagcattaagaag
acagaatggtccagagaagaagaggaaaaactcttgcacttggccaagttgatgccaact
cagtggaggaccattgctccaatcattggaagaacagcggcccagtgcttagaacactat
gaatttcttctggataaagctgcccaaagagacaatgaagaggaaacaacagatgatcca
cgaaaacttaaacctggagaaatagatccaaatccagaaacaaaaccagcgcggcctgat
ccaattgatatggatgaggatgaacttgagatgctttctgaagccagagcccgcttggct
aatactcagggaaagaaggccaagaggaaagcaagagagaaacaattggaagaagcaaga
cgtcttgctgccctccaaaaaagaagagaacttcgagcagctggcatagaaattcagaag
aaaagaaaaaggaagagaggagttgattataatgccgaaatcccatttgaaaaaaagcct
gcccttggtttttatgatacttctgaggaaaactaccaagctcttgacgcagatttcagg
aaattaagacaacaggatcttgatggggagctaagatctgaaaaagaaggaagagataga
aaaaaagacaaacagcatttgaaaaggaaaaaagaatctgatttaccatcagctattctt
caaactagtggtgtttctgaatttactaaaaagagaagcaaactagtacttcctgcccct
cagatttcagatgcagaactccaggaagttgtaaaagtaggccaagcgagtgaaattgca
cgtcaaactgccgaggaatctggcataacaaattctgcttccagtacacttttgtctgag
tacaatgtcaccaacaacagcgttgctcttagaacaccacgaacaccagcttcccaggac
agaattctgcaggaagcccagaacctcatggccctcaccaatgtggacaccccattgaaa
ggtggacttaataccccattgcatgagagtgacttctcaggtgtaactccacagcgacaa
gttgtacagactccaaacacagttctctctactccattcaggactccttctaatggagct
gaagggctgactccccggagtggaacaactcccaaaccagttattaactctactccgggt
agaactcctcttcgagacaagttaaacattaatcccgaggatggaatggcagactatagt
gatccctcttacgtgaagcagatggaaagagaatcccgagaacatctccgtttagggttg
ttgggccttcctgcccctaagaatgattttgaaattgttctaccagaaaatgccgagaag
gagctggaagaacgtgaaatagatgatacttacattgaagatgctgctgatgtggatgct
cgaaagcaggccatacgagatgcagagcgtgtaaaggaaatgaaacgaatgcataaagct
gtccagaaagatctgccaagaccatcagaagtaaatgaaactattctaagacccttaaat
gtagaaccgcctttaacagatttacagaaaagtgaagaactaatcaaaaaagaaatgatc
acaatgcttcattatgaccttctacatcacccttatgaaccatctggaaataaaaaaggc
aaaactgtagggtttggtaccaataattcagagcacattacctatctggaacataatcct
tatgaaaagttctccaaagaagagctgaaaaaggcccaggatgttttggtgcaggagatg
gaagtggttaaacaaggaatgagccatggagagctctcaagtgaagcttataaccaggtg
tgggaagaatgctacagtcaagttttatatcttcctgggcagagccgctacacacgggcc
aatctggctagtaaaaaggacagaattgaatcacttgaaaagaggctcgagataaacagg
ggtcacatgacgacagaagccaagagggctgcaaagatggaaaagaagatgaaaattttg
cttgggggttaccagtctcgtgctatggggctcatgaaacagttgaatgacttatgggac
caaattgaacaggctcacttggagttacgcacttttgaagaactcaagaaacatgaagat
tctgctattccccggaggctagagtgtctaaaagaagacgttcagcgacaacaagaaaga
gaaaaggaacttcaacatagatatgctgatttgctgctggagaaagagactttaaagtca
aaattctga

DBGET integrated database retrieval system