KEGG   Homo sapiens (human): 9886
Entry
9886              CDS       T01001                                 
Symbol
RHOBTB1
Name
(RefSeq) Rho related BTB domain containing 1
  KO
K07868  Rho-related BTB domain-containing protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9886 (RHOBTB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9886 (RHOBTB1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    9886 (RHOBTB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9886 (RHOBTB1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoBTB
    9886 (RHOBTB1)
SSDB
Motif
Pfam: BTB Ras Roc
Other DBs
NCBI-GeneID: 9886
NCBI-ProteinID: NP_001229288
OMIM: 607351
HGNC: 18738
Ensembl: ENSG00000072422
Pharos: O94844(Tdark)
UniProt: O94844 A0A024QZL4
Position
10:complement(60860860..61001967)
AA seq 696 aa
MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKS
MWYPEIKHFCPRTPVILVGCQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKE
LGLPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKAPP
PVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFAHRIYLATSSSKFYDLFLMEC
EESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSNKSLVEALGLE
AEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYT
GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLS
KGTFSDVTFKLDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVL
DYLYTKQLSPNLDLDPLELIALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSY
LELAQFHNAHQLAAWCLHHICTNYNSVCSKFRKEIKSKSADNQEYFERHRWPPVWYLKEE
DHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggacgctgacatggactacgaaagacccaacgttgaaactatcaaatgtgtggtcgtg
ggtgacaatgccgtggggaagacgcgcttgatctgtgccagggcgtgcaacaccacactc
acgcagtatcagctgctggccacccacgtgccaacagtgtgggcgattgaccagtaccgc
gtgtgccaggaggtcttggagcgttctcgggatgttgttgatgaagtgagtgtttctctc
aggctttgggatacttttggtgatcatcacaaagacagacgctttgcatatggcaggtct
gatgttgtggtcctctgtttttcgattgctaatcccaattccctaaatcatgtgaaaagc
atgtggtatccagaaatcaagcacttttgccctcgaacacccgttatccttgttgggtgc
cagcttgatctccgctatgccgacctggaagctgttaatcgagccaggcgcccgttagca
aggcccataaagagaggggatattttgcccccagaaaaaggccgagaggtagcaaaggaa
cttggcttaccatactatgaaacaagcgtgtttgaccagtttggtatcaaggatgtgttt
gacaatgcaatccgagcagcgctgatttcccgcaggcacctgcaattctggaaatcccac
ctaaagaaagtccagaaacctttacttcaggcacccttcctacctccaaaagcccctcca
ccggtcatcaaaattccagagtgtccttccatggggacaaatgaagctgcctgtttactg
gacaatcctctatgtgccgatgttctgttcatccttcaggaccaggaacacatctttgca
catcgaatttacctcgctacctcttcttccaaattttatgatctgtttttaatggaatgt
gaagaatccccaaatgggagtgaaggagcctgtgagaaagagaagcagagcagagatttc
caggggcggatattgagtgtcgacccagaggaagaaagggaggagggcccgcctaggatt
cctcaggccgaccagtggaagtcttcaaacaagagcctggtggaggctctggggctggaa
gccgagggtgcagttcctgagacacagactttgaccggatggagtaaggggttcattggc
atgcacagggaaatgcaagtcaaccccatttcaaagcggatggggcccatgactgtggtc
aggatggacgcttcagtccagccaggcccttttcggaccctgctccagtttctttatacg
ggacaactggatgaaaaggaaaaggatttggtgggcctggctcagatcgcagaggtcctc
gagatgttcgatttgaggatgatggtggaaaacatcatgaacaaggaagccttcatgaac
caggagattacgaaagcctttcacgtaaggaaagccaatcggataaaagagtgtctcagc
aagggaacgttctcggacgtgacatttaaattggacgatggagccatcagtgcccacaag
ccgctgctgatctgtagctgtgagtggatggcagccatgttcggggggtcatttgtggaa
agtgccaacagtgaggtgtatctcccgaacataaacaagatatcaatgcaagcagtattg
gattatctctataccaagcagttgtctcctaacttggatctggacccgctggaattaatt
gccttggcaaacagattttgcctgccacacttggttgcacttgcagaacagcatgccgtt
caggagttgaccaaagccgccacgagtggcgtgggcattgacggagaagtgctctcttac
ttggaattggctcagtttcacaatgcccaccagttggccgcctggtgtttgcaccacatc
tgcaccaactacaacagtgtatgctccaagttccgtaaggaaatcaaatcaaaatctgca
gacaaccaggaatacttcgagcggcaccgctggccccctgtgtggtacctgaaggaagaa
gatcactaccagcgtgtgaaaagggaacgagagaaggaagatattgcactaaataagcat
cgctcaagacgaaagtggtgcttctggaattcatctccagcagtggcctga

DBGET integrated database retrieval system