KEGG   Homo sapiens (human): 9891Help
Entry
9891              CDS       T01001                                 

Gene name
NUAK1, ARK5
Definition
(RefSeq) NUAK family kinase 1
  KO
K08800  NUAK family, SNF1-like kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9891 (NUAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9891 (NUAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   9891 (NUAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 9891
NCBI-ProteinID: NP_055655
OMIM: 608130
HGNC: 14311
Ensembl: ENSG00000074590
Vega: OTTHUMG00000169763
Pharos: O60285(Tchem)
UniProt: O60285 A0A024RBL3
Position
12q23.3
AA seq 661 aa AA seqDB search
MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQET
LGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYE
VFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLK
LENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALG
VLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNPDRRATIEDI
ANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEV
MLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYS
SPERSESSELLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPAL
VSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRS
CVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKL
N
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggccgccgcgcctgtggcgggggaccgccccgacttggggctgggggcgccg
ggctctccccgagaggcggtggcgggggcgactgcagccctggagcccaggaagccgcac
ggggtgaagcggcatcaccacaagcacaacttgaagcaccgctacgagctgcaggagacc
ctgggcaaaggcacctacggcaaagtcaagcgggccaccgagaggttttctggccgagtg
gttgctataaaatccattcgtaaggacaaaattaaggatgaacaagacatggttcacatc
agacgagagattgagatcatgtcatctctcaaccatcctcatatcatcagtatttatgaa
gtgtttgagaacaaagataagattgtgatcatcatggaatatgccagcaaaggggagctg
tacgattacatcagtgagcggcgacgcctcagtgagagggagacccggcacttcttccgg
cagatcgtctctgctgtgcactattgtcacaagaacggtgtggtccaccgggacttgaag
ctggaaaatatactgctcgatgacaactgcaatattaagattgctgactttgggctttcc
aacctgtaccagaaggataagttcttacaaacgttttgtgggagtccactctatgcatct
cctgagattgtcaatgggagaccttaccgagggccagaggtggacagctgggccctgggt
gtgttgctttacactcttgtttatggaacaatgcccttcgatggtttcgatcacaaaaac
ctcattcggcaaatcagcagcggagagtaccgggagccaacacagccctcagatgctcga
ggactcatacggtggatgctgatggtgaaccccgatcgccgggccactattgaggacatt
gccaaccactggtgggtgaactggggctataagagcagcgtgtgtgactgtgatgccctc
catgactctgagtccccactcctggctcggatcattgactggcaccaccgttccacaggg
ctgcaggctgacaccgaagccaaaatgaagggcctggccaaacccacgacctctgaggtc
atgctagagcggcagcggtcgctgaagaaatccaagaaagagaatgactttgctcagtct
ggtcaggatgcagtgcctgaaagcccatccaagttgagttctaagaggcccaaggggatc
ctgaagaagcgaagcaacagcgagcatcgctctcacagcactggcttcattgaaggtgta
gttggtcctgccttaccctctactttcaagatggagcaggacttgtgcaggactggcgtg
ctcctcccaagctcaccagaggcagaggtgccgggaaaactcagccccaagcagtcggcc
acgatgcccaagaaaggcatcttgaaaaagacccagcagagagaatcaggttactactct
tccccagagcgcagtgagtcttcggagctgttggacagtaatgatgtgatgggcagcagc
atcccctcccccagccccccggacccagccagggtaacctcccacagcctctcctgccgg
aggaagggcatcttgaaacacagcagcaaatactcagcgggcaccatggacccagccctg
gtcagccctgaaatgcccacactggaatccctgtcagagcctggtgtccctgccgagggc
ctctcccggagctacagccgcccttccagtgtcatcagcgatgacagcgtgctgtccagc
gactcttttgacttgctggatttgcaggagaatcgccctgcccgccagcgcatccgcagc
tgcgtctctgcagaaaacttcctccagatccaggactttgaggggctccagaaccggccc
cggccccagtacctgaagcggtaccggaaccggctggcagacagcagcttctccctcctc
acagacatggatgatgtgactcaggtctacaagcaagcgctggagatctgcagcaagctc
aactag

DBGET integrated database retrieval system