KEGG   Homo sapiens (human): 9894Help
Entry
9894              CDS       T01001                                 

Gene name
TELO2, CLK2, TEL2, YHFS
Definition
(RefSeq) telomere maintenance 2
  KO
K11137  telomere length regulation protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa04150  mTOR signaling pathway
Disease
H01789  You-Hoover-Fong syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    9894 (TELO2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    9894 (TELO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    9894 (TELO2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    9894 (TELO2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     9894 (TELO2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     9894 (TELO2)
  Check point factors
   Triple T complex
    9894 (TELO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Telomere_reg-2 RIX1
Motif
Other DBs
NCBI-GeneID: 9894
NCBI-ProteinID: NP_057195
OMIM: 611140
HGNC: 29099
Ensembl: ENSG00000100726
Vega: OTTHUMG00000044471
Pharos: Q9Y4R8(Tbio)
UniProt: Q9Y4R8 B4DXS2
Position
16p13.3
AA seq 837 aa AA seqDB search
MEPAPSEVRLAVREAIHALSSSEDGGHIFCTLESLKRYLGEMEPPALPREKEEFASAHFS
PVLRCLASRLSPAWLELLPHGRLEELWASFFLEGPADQAFLVLMETIEGAAGPSFRLMKM
ARLLARFLREGRLAVLMEAQCRQQTQPGFILLRETLLGKVVALPDHLGNRLQQENLAEFF
PQNYFRLLGEEVVRVLQAVVDSLQGGLDSSVSFVSQVLGKACVHGRQQEILGVLVPRLAA
LTQGSYLHQRVCWRLVEQVPDRAMEAVLTGLVEAALGPEVLSRLLGNLVVKNKKAQFVMT
QKLLFLQSRLTTPMLQSLLGHLAMDSQRRPLLLQVLKELLETWGSSSAIRHTPLPQQRHV
SKAVLICLAQLGEPELRDSRDELLASMMAGVKCRLDSSLPPVRRLGMIVAEVVSARIHPE
GPPLKFQYEEDELSLELLALASPQPAGDGASEAGTSLVPATAEPPAETPAEIVDGGVPQA
QLAGSDSDLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEG
LVYRSPTATREVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFY
ALNYSLRQRMDILDVLTLAAQELSRPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASD
WRVVVEERIRSKTQRLSKGGPRQGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGED
QLVLGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLS
LPAARLLEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggagccagcaccctcagaggttcgactcgccgtccgggaagccattcatgccctctcg
tcttcggaggatggcggccacatcttctgcaccctggagtccctgaagcggtatctcggt
gagatggagcctccagcgctcccgagggagaaggaggagtttgcctcggcccacttctcg
cctgtcctcagatgtcttgccagcaggctgagcccagcctggctggagctgctgccccat
ggccgcctggaggagctgtgggccagcttcttcctggagggcccggcggaccaagccttc
ctggtgttgatggagaccatcgagggtgctgcgggccccagcttccggctgatgaagatg
gcgcggctgctggccagattcctgcgcgagggccggctggcagtgctgatggaggcgcag
tgtcggcagcagacgcagcccggcttcatcctgctccgggagacgctgctgggcaaggtg
gtggccctgcccgatcacctgggcaaccgcctgcagcaggagaacttggccgagttcttc
ccccagaactacttccgcctgctcggcgaggaggtcgtccgggtgctgcaggcggttgtg
gactctctccaaggtggcctggattcctccgtgtccttcgtgtctcaggtccttgggaaa
gcctgtgtccacgggaggcagcaggagatcctgggcgtgctggtaccccggctggcagcg
ctcacccagggcagctacctgcaccagcgcgtctgctggcgcctggtggagcaagtgccg
gaccgggccatggaggctgtgctgaccgggctggtggaggccgcactggggcctgaggtc
ctttcgagactgctggggaacctggtggtgaagaacaagaaggcccagtttgtgatgacc
cagaagcttctgttcttacagtcccggctcacgacgcccatgctgcagagcctgctgggc
catctggccatggacagccagcggcgcccgctcctgctgcaggtgctgaaggagctgttg
gagacgtggggcagcagcagtgccatccgccacactcccctgccgcagcagcgccacgtc
agcaaggctgtcctcatctgcctggcgcaactcggggagccggaactgcgggacagccgg
gatgaactgctggccagcatgatggcgggcgtgaagtgccgcctggacagtagcctgccc
cccgtgcgacgcctgggcatgatcgtggcagaggtcgttagtgcccggatccaccccgag
gggcctcccctgaaattccagtacgaagaggatgaactgagcctcgagctgctggccttg
gcctccccccagcctgcgggtgacggcgcctcggaggcgggcacgtccctcgttccagcc
acggcagagccccctgcagagacccccgcagagatcgtggatggcggcgtcccccaagca
cagctggcgggctctgactcggacctggacagcgatgatgagtttgtcccctacgacatg
tcgggggacagagagctgaagagcagcaaggctcctgcctacgtccgggactgcgtggaa
gccctgaccacgtctgaggacatagagcgctgggaggcagccctgcgggcccttgagggc
ctggtctacaggagccccacagccactcgggaggtgagcgtggagctggccaaggtgctt
ctgcatctggaggagaagacctgtgtggtgggatttgcagggctgcgccagagagccctg
gtggccgtcacggtcacagacccggccccggtggccgactatctgacctcacagttctat
gccctcaactacagcctccggcagcgcatggacatcctggatgtgctgactctggctgcc
caggagctgtctaggcctgggtgcctcgggaggactccccaacctggctccccaagtccc
aacaccccgtgcctgccagaggcagccgtctctcagcctggcagtgccgtggcgtctgac
tggcgggtggtggtggaggagcggatcagaagcaagacccagcggctctccaagggtggc
ccgaggcagggcccggcaggcagccccagcagattcaactccgtggccggccacttcttc
ttccccctccttcagcgctttgacaggcctctggtgaccttcgacctcttgggagaagac
cagctggttctcggaaggctggcgcacaccttaggggccctgatgtgcctggctgttaac
accacggtggctgtggccatgggcaaggccctgctggaattcgtgtgggcccttcgcttc
cacatcgatgcctacgtgcgccaggggctgttgtcggccgtctcctccgtcctgctcagc
ctgcctgctgcgcgcctgctggaggacctgatggacgagctgctggaagcccggtcctgg
ctggcggacgtggctgagaaagacccggacgaggactgcaggacgctggcactgagggcc
ctgctgcttctgcagagactcaagaacaggctcctcccacccgcgtctccctag

DBGET integrated database retrieval system