KEGG   Homo sapiens (human): 9895
Entry
9895              CDS       T01001                                 
Symbol
TECPR2, HSAN9, KIAA0329, SPG49
Name
(RefSeq) tectonin beta-propeller repeat containing 2
  KO
K23881  tectonin beta-propeller repeat-containing protein 2
Organism
hsa  Homo sapiens (human)
Network
nt06532  Autophagy
  Element
N01721  Autophagosome and lysosome fusion, tethering factor
Disease
H00265  Hereditary sensory and autonomic neuropathy
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9895 (TECPR2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    9895 (TECPR2)
SSDB
Motif
Pfam: Hyd_WA Tectonin WD40 ANAPC4_WD40 WD40_like
Other DBs
NCBI-GeneID: 9895
NCBI-ProteinID: NP_055659
OMIM: 615000
HGNC: 19957
Ensembl: ENSG00000196663
UniProt: O15040
Position
14:102362941..102502477
AA seq 1411 aa
MASISEPVTFREFCPLYYLLNAIPTKIQKGFRSIVVYLTALDTNGDYIAVGSSIGMLYLY
CRHLNQMRKYNFEGKTESITVVKLLSCFDDLVAAGTASGRVAVFQLVSSLPGRNKQLRRF
DVTGIHKNSITALAWSPNGMKLFSGDDKGKIVYSSLDLDQGLCNSQLVLEEPSSIVQLDY
SQKVLLVSTLQRSLLFYTEEKSVRQIGTQPRKSTGKFGACFIPGLCKQSDLTLYASRPGL
RLWKADVHGTVQATFILKDAFAGGVKPFELHPRLESPNSGSCSLPERHLGLVSCFFQEGW
VLSWNEYSIYLLDTVNQATVAGLEGSGDIVSVSCTENEIFFLKGDRNIIRISSRPEGLTS
TVRDGLEMSGCSERVHVQQAEKLPGATVSETRLRGSSMASSVASEPRSRSSSLNSTDSGS
GLLPPGLQATPELGKGSQPLSQRFNAISSEDFDQELVVKPIKVKRKKKKKKTEGGSRSTC
HSSLESTPCSEFPGDSPQSLNTDLLSMTSSVLGSSVDQLSAESPDQESSFNGEVNGVPQE
NTDPETFNVLEVSGSMPDSLAEEDDIRTEMPHCHHAHGRELLNGAREDVGGSDVTGLGDE
PCPADDGPNSTQLPFQEQDSSPGAHDGEDIQPIGPQSTFCEVPLLNSLTVPSSLSWAPSA
EQWLPGTRADEGSPVEPSQEQDILTSMEASGHLSTNLWHAVTDDDTGQKEIPISERVLGS
VGGQLTPVSALAASTHKPWLEQPPRDQTLTSSDEEDIYAHGLPSSSSETSVTELGPSCSQ
QDLSRLGAEDAGLLKPDQFAESWMGYSGPGYGILSLVVSEKYIWCLDYKGGLFCSALPGA
GLRWQKFEDAVQQVAVSPSGALLWKIEQKSNRAFACGKVTIKGKRHWYEALPQAVFVALS
DDTAWIIRTSGDLYLQTGLSVDRPCARAVKVDCPYPLSQITARNNVVWALTEQRALLYRE
GVSSFCPEGEQWKCDIVSERQALEPVCITLGDQQTLWALDIHGNLWFRTGIISKKPQGDD
DHWWQVSITDYVVFDQCSLFQTIIHATHSVATAAQAPVEKVADKLRMAFWSQQLQCQPSL
LGVNNSGVWISSGKNEFHVAKGSLIGTYWNHVVPRGTASATKWAFVLASAAPTKEGSFLW
LCQSSKDLCSVSAQSAQSRPSTVQLPPEAEMRAYAACQDALWALDSLGQVFIRTLSKSCP
TGMHWTRLDLSQLGAVKLTSLACGNQHIWACDSRGGVYFRVGTQPLNPSLMLPAWIMIEP
PVQPAGVSLVSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALS
TRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRL
TKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI
NT seq 4236 nt   +upstreamnt  +downstreamnt
atggcatcgatatcagagcctgttacattcagagagttctgcccgttgtactatctcctc
aatgccattccgacaaagatccagaagggtttccgctctatcgtggtctatctcacggcc
ctcgacaccaacggggactacatcgcggtgggcagcagcatcggcatgctctatctgtac
tgccggcacctcaaccagatgaggaagtacaactttgaggggaagacggaatctatcact
gtggtgaagctgctgagctgctttgatgacctggtggcagcaggcacagcctctggcagg
gttgcagtttttcaacttgtatcttcattgccagggagaaataaacagcttcggagattt
gatgtcactggtattcacaaaaatagcattacagctctggcttggagccccaatggaatg
aaattgttctctggagatgacaaaggcaaaattgtttattcttctctggatctagaccag
gggctctgtaactcccagctggtgttggaggagccatcttccattgtgcagctggattat
agccagaaagtgctgctggtctctactctgcaaagaagtctgctcttttacactgaagaa
aagtctgtaaggcaaattggaacacaaccaaggaaaagtactgggaaatttggtgcttgt
tttataccaggactctgtaagcaaagtgatctaaccttgtatgcgtcacggcccgggctc
cggctatggaaggctgatgtccacgggactgttcaagccacgtttatcttaaaagatgct
tttgccgggggagtcaagccttttgaactgcacccgcgtctggaatcccccaacagtgga
agttgcagcttacctgagaggcacctggggcttgtttcatgtttctttcaagaaggctgg
gtgctgagttggaatgaatatagtatctatctcctagacacagtcaaccaggccacagtt
gctggtttggaaggatccggtgatattgtgtctgtttcgtgcacagaaaatgaaatattt
ttcttgaaaggagataggaacattataagaatttcaagcaggcctgaaggattaacatca
acagtgagagatggtctggagatgtctggatgctcagagcgtgtccacgtgcagcaagcg
gagaagctgccaggggccacagtttctgagacgaggctcagaggctcttccatggccagc
tccgtggccagcgagccaaggagcaggagcagctcgctcaactccaccgacagcggctcc
gggctcctgccccctgggctccaggccacccctgagctgggcaagggcagccagcccctg
tcacagagattcaacgccatcagctcagaggactttgaccaggagcttgtcgtgaagcct
atcaaagtgaaaaggaagaagaagaagaagaagacagaaggtggaagcaggagcacctgt
cacagctccctggaatcgacaccctgctccgaatttcctggggacagtccccagtccttg
aacacagacttgctgtcgatgacctcaagtgtcctgggcagtagcgtggatcagttaagt
gcagagtctccagaccaggaaagcagcttcaatggtgaagtgaacggtgtcccacaggaa
aatactgaccccgaaacgtttaatgtcctggaggtgtcaggatcaatgcctgattctctg
gctgaggaagatgacattagaactgaaatgccacactgtcaccatgcacatgggcgggag
ctgctcaatggagcgagggaagatgtgggaggcagtgatgtcacgggactcggagatgag
ccgtgtcctgcagatgatggaccaaatagcacacagttacccttccaagaacaggacagc
tctcctggggcgcatgatggggaagacatccaacccattggcccccaaagcactttttgt
gaagtccccctcctgaactcactcactgtgccttccagcctcagctgggccccaagtgct
gaacagtggctgcctgggaccagagctgatgaaggcagccccgtggagcccagccaagag
caggacatcctaaccagcatggaggcctctggccacctcagcacaaatctctggcatgct
gtcactgatgatgacacaggtcagaaagaaatacccatttctgaacgtgtcttggggagt
gtgggaggacagctgactccggtctctgccttggcagccagcactcacaagccctggctt
gagcagcctccacgggatcagacattgacgtccagcgatgaggaggacatctatgcccac
gggcttccttcttcatcctcagagacgagtgtgacagagctcggacctagttgctcccag
caggacctgagccggctgggtgcagaggacgccgggctgctcaagccagatcagtttgca
gaaagctggatgggctactcgggtcccggctatggcatcctcagcttggtggtctccgag
aagtatatctggtgcctggactacaaaggcggcctgttctgcagcgcgttgccgggcgcc
gggctgcgctggcagaagtttgaagatgctgtccagcaggtggcagtctcgccctcagga
gcccttctctggaagattgaacagaaatctaaccgggcttttgcttgtgggaaagtcacc
atcaaggggaagcggcactggtacgaagccctgccccaggcagtgtttgtggccctgagc
gatgacacggcctggatcatcaggaccagtggggacctatacttgcagacaggtctgagc
gtggatcgcccttgtgccagagccgtaaaggtggactgtccctacccgctgtcccagatc
acagcccggaacaatgtggtgtgggcgctgacagagcagagggccctcctgtaccgggag
ggcgtgagcagcttctgtccggaaggcgagcagtggaagtgtgacattgtcagcgaaagg
caagctttagaacccgtctgcataacgctcggggatcagcagactctctgggccctggac
atccatgggaacctgtggttcagaactggcattatttccaagaagccccaaggagatgac
gaccattggtggcaagtgagcatcacggactatgtggtgtttgaccagtgcagcttattt
cagacgataatccatgccactcactcggtggccacagcagcccaagcccccgtagaaaag
gtggcagataagctgcgcatggcgttttggtcccagcagcttcagtgccagccaagcctt
ctcggggtcaataacagcggtgtctggatctcctcgggcaagaatgaattccacgtcgct
aagggaagtctcataggcacctactggaatcatgtggttccccgtgggacagcttctgct
acaaaatgggcctttgtgttggcttctgcagctcccacgaaggaaggaagcttcctgtgg
ctgtgccagagcagcaaggacctgtgcagcgtcagcgcccagagcgcacagtcgcggccc
tccacggtgcagctgcctcccgaagccgagatgcgcgcctatgccgcctgccaggatgcg
ctgtgggcgctggacagcctcggccaggtgttcatcaggacgctctccaagagctgcccc
acgggcatgcactggaccaggctggacctctcccagctaggagctgtaaaattgacaagc
ttggcatgtggaaatcagcacatctgggcctgtgattccaggggtggagtttacttccgt
gtagggactcagcctctcaatcccagtctcatgcttccagcctggataatgattgagcca
cctgtccagcccgccggggtcagcttggtcagcgtccattccagccccaacgaccagatg
ctgtgggtgcttgacagcaggtggaacgtgcacgtgcggaccgggatcaccgaggagatg
cctgtggggaccgcctgggagcatgtgccagggttgcaggcctgccagctggcgctgagc
accaggaccgtgtgggcccgctgtccaaacggagacctcgcccggcggtacggcgtcaca
gacaagaaccccgccggggactactggaagaaaattcccggcagcgtgtcgtgtttcaca
gtgactgcgtcagatgagctgtgggctgtgggcccgcccggctacctcctccaacggctg
acaaagacgttcagccactcgcacggcacccagaagagcagccaggccgccatgccccac
cctgaggacctggaggacgagtgggaggtcatctga

DBGET integrated database retrieval system