KEGG   Homo sapiens (human): 9899
Entry
9899              CDS       T01001                                 

Gene name
SV2B, HsT19680
Definition
(RefSeq) synaptic vesicle glycoprotein 2B
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Drug target
Padsevonil: D11842
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    9899 (SV2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9899 (SV2B)
Transporters [BR:hsa02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    9899 (SV2B)
SSDB
Motif
Pfam: MFS_1 Sugar_tr Pentapeptide_4 Pentapeptide_3
Other DBs
NCBI-GeneID: 9899
NCBI-ProteinID: NP_001309960
OMIM: 185861
HGNC: 16874
Ensembl: ENSG00000185518
Vega: OTTHUMG00000149833
Pharos: Q7L1I2(Tbio)
UniProt: Q7L1I2
Position
15q26.1
AA seq 683 aa
MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVK
AKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALM
ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSM
SLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLG
IFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPCTVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFIEIQSSTGTWY
QRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRYFQD
EEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFE
DVTSTDTYFKNCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYL
VSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLA
AASLVGGGLIALRLPETREQVLM
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggatgactacaagtatcaggacaattatgggggctatgctcccagtgatggctattac
cgcggcaatgagtccaacccagaagaagatgcacagagtgatgtcaccgaaggccatgat
gaggaagacgagatctatgagggcgagtaccagggtatccctcacccagatgatgtcaag
gccaagcaggccaagatggcgccctccagaatggacagccttcggggccagacagacctg
atggctgagaggctggaagatgaggagcagttggcccaccagtacgagaccatcatggat
gagtgtggccatggccgcttccagtggatcctctttttcgtcttgggtttggccctgatg
gccgatggggtggaagtgttcgtggtgagttttgccctgcccagtgcagagaaggacatg
tgtctgtccagttccaaaaaaggaatgctagggatgatagtctacttgggaatgatggcg
ggcgccttcatcctgggaggcctggctgataagctgggaaggaagcgagtcctcagcatg
tctctggccgtcaatgcctccttcgcctccctctcttccttcgtgcagggatatggagcc
ttcctcttctgccgactcatctcaggcatcggtattgggggtgctctaccgattgttttt
gcctatttttctgaattcttgtctcgggagaagcgaggagaacacctcagttggctgggc
atcttctggatgactgggggcctgtacgcatctgccatggcctggagcatcatcccacac
tatggctggggcttcagcatggggaccaattaccacttccatagctggagagtgtttgtc
atcgtctgtgctctgccctgcaccgtgtccatggtggccctgaagttcatgccagagagc
ccaaggtttctgctagagatgggcaaacatgatgaagcctggatgattctcaagcaagtc
catgacaccaacatgagagctaaggggaccccagagaaagtgttcacggtttccaacatc
aaaactcccaagcaaatggatgaattcattgagatccaaagttcaacaggaacctggtac
cagcgctggctggtcagattcaagaccattttcaagcaggtctgggataatgccctgtac
tgtgtgatggggccctacagaatgaatacactgattctggccgtggtttggtttgccatg
gcattcagttactatggactgacagtttggtttcctgatatgatccgctattttcaagat
gaagaatacaagtctaaaatgaaggtgttttttggtgagcatgtgtacggcgccacaatc
aacttcacgatggaaaatcagatccaccaacatgggaaacttgtgaatgataagttcaca
agaatgtactttaaacatgtactctttgaggacacattctttgacgagtgctattttgaa
gacgtaacatcaacagatacctacttcaaaaattgtaccattgaatcaaccatcttttac
aacacagacctctacgagcacaagttcatcaactgtcggtttatcaactccaccttcctg
gagcagaaggagggctgccacatggacttggagcaagataatgacttcctgatttacctc
gtcagcttcctgggcagcctgtctgtcttacccgggaacatcatttctgccctgctcatg
gatagaattggaaggctcaagatgattggtggctccatgctaatctctgcagtctgctgc
ttcttcctgttttttggcaacagtgagtctgcaatgatcggctggcagtgcctgttctgt
gggacaagcattgcagcctggaatgctctggatgtgatcacagtggagctgtatcccacc
aaccagagagcaacagccttcggcattctcaatggattatgcaaatttggcgccatcctg
ggaaacaccatctttgcttcttttgttgggataaccaaagtggtccccatccttctggct
gctgcttctctggttgggggtggcctgattgcccttcgactgccagagactcgagaacag
gtcctgatgtga

DBGET integrated database retrieval system