KEGG   Homo sapiens (human): 990Help
Entry
990               CDS       T01001                                 

Gene name
CDC6, CDC18L, HsCDC18, HsCDC6, MGORS5
Definition
(RefSeq) cell division cycle 6
  KO
K02213  cell division control protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    990 (CDC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    990 (CDC6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    990 (CDC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cdc6_C AAA_22 AAA_16 AAA NACHT AAA_19 DUF2075 AAA_30 DUF815 NB-ARC Pox_A32 NTPase_1 Zot T2SSE ResIII AAA_5 ORC5_C Helicase_RecD RNA_helicase
Motif
Other DBs
NCBI-GeneID: 990
NCBI-ProteinID: NP_001245
OMIM: 602627
HGNC: 1744
Ensembl: ENSG00000094804
Vega: OTTHUMG00000133324
Pharos: Q99741(Tbio)
UniProt: Q99741 A0A024R1S2
Structure
PDB: 

Position
17q21.2
AA seq 560 aa AA seqDB search
MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLG
DDNLCNTPHLPPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKI
LSSVRKSQEITTNSEQRCPLKKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMD
VIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQ
AVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLN
QVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEV
TLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKE
IEHALKDKALIGNILATGLP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaacccgatcccaggcacaggctacaatcagttttccaaaaaggaagctgtct
cgggcattgaacaaagctaaaaactccagtgatgccaaactagaaccaacaaatgtccaa
accgtaacctgttctcctcgtgtaaaagccctgcctctcagccccaggaaacgtctgggc
gatgacaacctatgcaacactccccatttacctccttgttctccaccaaagcaaggcaag
aaagagaatggtccccctcactcacatacacttaagggacgaagattggtatttgacaat
cagctgacaattaagtctcctagcaaaagagaactagccaaagttcaccaaaacaaaata
ctttcttcagttagaaaaagtcaagagatcacaacaaattctgagcagagatgtccactg
aagaaagaatctgcatgtgtgagactattcaagcaagaaggcacttgctaccagcaagca
aagctggtcctgaacacagctgtcccagatcggctgcctgccagggaaagggagatggat
gtcatcaggaatttcttgagggaacacatctgtgggaaaaaagctggaagcctttacctt
tctggtgctcctggaactggaaaaactgcctgcttaagccggattctgcaagacctcaag
aaggaactgaaaggctttaaaactatcatgctgaattgcatgtccttgaggactgcccag
gctgtattcccagctattgctcaggagatttgtcaggaagaggtatccaggccagctggg
aaggacatgatgaggaaattggaaaaacatatgactgcagagaagggccccatgattgtg
ttggtattggacgagatggatcaactggacagcaaaggccaggatgtattgtacacgcta
tttgaatggccatggctaagcaattctcacttggtgctgattggtattgctaataccctg
gatctcacagatagaattctacctaggcttcaagctagagaaaaatgtaagccacagctg
ttgaacttcccaccttataccagaaatcagatagtcactattttgcaagatcgacttaat
caggtatctagagatcaggttctggacaatgctgcagttcaattctgtgcccgcaaagtc
tctgctgtttcaggagatgttcgcaaagcactggatgtttgcaggagagctattgaaatt
gtagagtcagatgtcaaaagccagactattctcaaaccactgtctgaatgtaaatcacct
tctgagcctctgattcccaagagggttggtcttattcacatatcccaagtcatctcagaa
gttgatggtaacaggatgaccttgagccaagaaggagcacaagattccttccctcttcag
cagaagatcttggtttgctctttgatgctcttgatcaggcagttgaaaatcaaagaggtc
actctggggaagttatatgaagcctacagtaaagtctgtcgcaaacagcaggtggcggct
gtggaccagtcagagtgtttgtcactttcagggctcttggaagccaggggcattttagga
ttaaagagaaacaaggaaacccgtttgacaaaggtgtttttcaagattgaagagaaagaa
atagaacatgctctgaaagataaagctttaattggaaatatcttagctactggattgcct
taa

DBGET integrated database retrieval system