KEGG   Homo sapiens (human): 9903Help
Entry
9903              CDS       T01001                                 

Gene name
KLHL21
Definition
(RefSeq) kelch like family member 21
  KO
K10458  kelch-like protein 21
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9903 (KLHL21)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     9903 (KLHL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BTB BACK Kelch_3 Kelch_2 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-GeneID: 9903
NCBI-ProteinID: NP_055666
OMIM: 616262
HGNC: 29041
Ensembl: ENSG00000162413
Vega: OTTHUMG00000001437
Pharos: Q9UJP4(Tbio)
UniProt: Q9UJP4
Position
1p36.31
AA seq 597 aa AA seqDB search
MERPAPLAVLPFSDPAHALSLLRGLSQLRAERKFLDVTLEAAGGRDFPAHRAVLAAASPY
FRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSYTGRVAVSGDNAEPLLRAADLLQFPA
VKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLERLPLAR
LLRYLRDDGLCVPKEEAAYQLALRWVRADPPRRAAHWPQLLEAVRLPFVRRFYLLAHVEA
EPLVARCPPCLRLLREARDFQAARYDRHDRGPCPRMRPRPSTGLAEILVLVGGCDQDCDE
LVTVDCYNPQTGQWRYLAEFPDHLGGGYSIVALGNDIYVTGGSDGSRLYDCVWRYNSSVN
EWAEVAPMLKAREYHSSSVLDGLLYVVAADSTERYDHTTDSWEALQPMTYPMDNCSTTAC
RGRLYAIGSLAGKETMVMQCYDPDTDLWSLVDCGQLPPWSFAPKTATLNGLMYFVRDDSA
EVDVYNPTRNEWDKIPSMNQVHVGGSLAVLGGKLYVSGGYDNTFELSDVVEAYDPETRAW
SVVGRLPEPTFWHGSVSIFRQFMPQTFSGGRGFELDSGSDDMDPGRPRPPRDPDELH
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaccggcgcccctggccgtgcttcccttctcggaccccgcgcacgccctgagc
ctgctgcgcggcctgagccagctgcgcgccgagcgcaagttcctggacgtgaccctggag
gcggcgggcgggcgcgacttcccggcgcaccgtgcggtgctggccgccgccagcccctac
ttccgcgccatgttcgcggggcagctgcgcgagagccgcgccgagcgggtgcgcctgcac
ggagtgcctcccgacatgctgcagctgctgctggacttcagctacacgggccgcgtggcg
gtaagcggcgacaacgctgagccgctgctgcgcgccgccgacctgctgcagttcccggcc
gtgaaggaggcgtgcggggccttcctgcagcagcagctcgacctggccaactgcctggac
atgcaggacttcgctgaggccttcagctgctcgggactggcgagcgcggcgcagcggttc
attctgcgccacgtgggcgagctgggcgccgagcagctggagcggctgccactggcgcgc
ctgctgcgctacctgcgggacgacgggctgtgtgtgcccaaggaggaggccgcctaccag
ctggcgctgcgctgggtccgcgctgacccgccgcgccgcgccgcgcactggccgcagctg
ctggaggccgtgcgcctgcccttcgtgcgccgcttctacctgttggcgcacgtcgaggcc
gagccgctggtggcgcgctgcccaccctgcctgcgcctgctgcgcgaggcgcgcgacttc
caggcggcgcgctacgaccgccacgaccgcgggccctgtccccgaatgcgtcctcgcccg
tccaccggtctcgccgagatcctcgtgctcgtgggcggctgcgaccaggactgtgacgag
ctggtcactgtcgactgctacaacccgcagacgggtcagtggcgctacctggccgagttc
ccagaccacctgggcggaggctacagcatcgtggcgctgggcaatgacatctacgtgacg
ggtgggtccgatggctcccggctctatgactgcgtgtggaggtacaactcaagcgtgaat
gagtgggcggaggtggcgcccatgctgaaggcccgcgagtaccacagctcctctgtgctg
gacggactgctgtacgtggtggccgccgacagcaccgagcgctatgaccacaccactgac
tcctgggaggccctgcagcccatgacctaccccatggacaactgctccaccactgcgtgc
cgtggccggctctatgccatcggctccctggctggcaaggagaccatggtgatgcagtgc
tacgacccggacaccgacctgtggtcgctggtggactgcggccagctcccgccctggtcc
ttcgcccccaagactgcgactctaaacggactcatgtactttgtcagggatgactccgct
gaggtggacgtgtacaacccgacgaggaacgaatgggacaagatcccgtccatgaatcag
gtacatgtggggggcagcctggccgtccttggggggaagctgtacgtctctgggggatac
gacaatacatttgaactctcggacgtggtagaggcctatgacccagagactcgcgcgtgg
agcgtggtggggcggctcccagaacccaccttctggcatggcagtgtcagcatcttccgc
cagttcatgccccagaccttctcgggtgggcgtggcttcgagttggacagtggcagcgat
gacatggacccaggccgaccccggccgccgcgggaccccgatgagctgcactag

DBGET integrated database retrieval system