KEGG   Homo sapiens (human): 9912
Entry
9912              CDS       T01001                                 
Symbol
ARHGAP44, NPC-A-10, RICH2
Name
(RefSeq) Rho GTPase activating protein 44
  KO
K21067  Rho GTPase-activating protein 44
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9912 (ARHGAP44)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    9912 (ARHGAP44)
SSDB
Motif
Pfam: BAR RhoGAP BAR_3 GemA
Other DBs
NCBI-GeneID: 9912
NCBI-ProteinID: NP_055674
OMIM: 617716
HGNC: 29096
Ensembl: ENSG00000006740
Pharos: Q17R89(Tbio)
UniProt: Q17R89 Q69Z00
Position
17:12789498..12991643
AA seq 818 aa
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA
EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDV
IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALR
EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI
KAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK
KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKL
QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPA
DRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTNWVARRGSSAGRKVSCAP
PSMQPPAPPAELAAPLPSPLPEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSA
QKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPF
GQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFT
STLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIP
SIHIELGSTLRLSPLEHMRRHSVTDKRDSEEESESTAL
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgaagaagcagttcaatcgcatgcgccagctggccaaccagacggtgggcagggctgaa
aagacagaagttttgagtgaagaccttcttcaggtggagaagcgtctggagctggtgaaa
caggtgtcccacagcacgcacaagaagctcaccgcatgtctgcagggccagcaaggggca
gaggctgacaagcgctccaaaaagttgcctttgacaacactggctcagtgtctgatggag
gggtcagctatcctgggagatgacacacttcttgggaagatgctgaaactctgtggagag
acggaggacaagctggctcaggagctgatacattttgagttgcaagtagagagagacgtg
attgagcccctgtttttgctggcggaggtggaaatcccaaatattcaaaagcagaggaaa
cacttagccaagttggtgctggacatggattcctcacgaaccaggtggcagcagacttcc
aagtcttcaggtttgtccagcagcttacagcctgcgggtgccaaggctgatgccctcagg
gaagaaatggaagaggctgccaacagagtggagatttgcagggaccagctctcagctgat
atgtacagttttgtggccaaagaaattgactatgcaaactactttcaaacgctaatagaa
gtgcaagctgaataccacaggaagtccctgacactattgcaggctgtattgcctcagatc
aaagcacaacaggaggcctgggtagagaagccttccttcgggaagccgctggaggagcac
ctcaccatcagcggccgggagatcgccttccccatcgaggcgtgtgtgaccatgctgctt
gagtgtgggatgcaggaggagggactcttccgagtagccccctctgcctccaaactgaag
aagctgaaagcggccctggactgctgcgtggtggatgtgcaggagtactcggcagacccc
cacgcaattgcaggagctttgaaatcttacctccgagagttgccagaacctcttatgacc
tttgaactctatgatgagtggatccaggcttccaatgtccaggagcaagacaagaagctt
caggctctatggaatgcttgtgaaaagttgcccaaggccaatcacaacaacatccgatac
ttgataaaatttttatccaagctgtcagaatatcaagatgtaaacaagatgactcccagt
aatatggcaattgttttaggacccaacctcctatggccacaagcagaagggaacattaca
gagatgatgaccacagtgtcgctgcaaattgttgggatcattgaacctatcatccagcat
gcagactggttcttccctggggagatagagttcaacattactggcaattatgggagtcca
gtacacgtgaaccataatgccaactacagctcaatgccctccccagacatggaccctgct
gaccggcgccagcccgagcaggcccgccggcccctcagcgtcgccacggataatatgatg
ctggagttttacaaaaaggatggccttaggaaaatccaaagcatgggtgtgagggtcatg
gacacaaactgggtggctcgaagaggctcctcggccggtcggaaagtgtcctgcgccccg
ccctccatgcagcctcccgccccgcccgccgagctggctgcgcccctgccttcgccgctg
ccggagcagcccctggacagccccgcggcccccgcgctctctccatccggcctgggcctc
cagcctgggcccgagcgcaccagcacaacaaaaagcaaggaactttctccaggctctgca
cagaaaggaagtccaggctccagccagggcacagcctgtgcagggactcaaccaggggct
caacctggagctcagccgggcgccagccccagccccagccagccgcctgcagaccagagt
cctcacaccctccggaaagtttcaaagaagctggcaccgattccacccaaggtccccttt
ggccagccgggggctatggcagaccagtccgctggccagccgtccccagtcagcctgtcc
cccaccccgcccagcaccccgtcaccctatggactgagctaccctcaggggtactccttg
gcctcgggccagctctccccagctgcagctcctcccctggcctctccttctgtctttaca
agcactttgagcaaatcgcggcccactcctaagccgcgacagagacctactctgccgcct
cctcagcctcccacagtaaacctctcggcctctagtccacagtccacggaggcccccatg
ctagatggcatgtcccctggggaaagcatgtctacagatcttgtccactttgatattccc
tcgatccacatagagctcgggtcgacgctccgcctgagtcccctggagcacatgcggcga
cactcagtaactgacaagagggactcggaggaggagtctgagagcaccgccctctga

DBGET integrated database retrieval system