KEGG   Homo sapiens (human): 9915Help
Entry
9915              CDS       T01001                                 

Gene name
ARNT2, WEDAS, bHLHe1
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05211  Renal cell carcinoma
Network
N00136  EWSR1-ATF1 fusion to transcriptional activation
Disease
H01797  Webb-Dattani syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    9915 (ARNT2)
   05202 Transcriptional misregulation in cancer
    9915 (ARNT2)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    9915 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9915 (ARNT2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    9915 (ARNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Motif
Other DBs
NCBI-GeneID: 9915
NCBI-ProteinID: NP_055677
OMIM: 606036
HGNC: 16876
Ensembl: ENSG00000172379
Vega: OTTHUMG00000165478
Pharos: Q9HBZ2(Tbio)
UniProt: Q9HBZ2 Q7Z3A3 X5DQN9 Q86TN1
Position
15q25.1
AA seq 717 aa AA seqDB search
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccggcggcggtcaaccctccggaaatggcttcagacatacctggatctgtg
acgttgcccgttgcccccatggcggccaccggacaggtgaggatggcgggggccatgcct
gcccgtggaggaaagcggcgttccggaatggacttcgatgatgaagatggtgaaggcccc
agtaaattttcaagagagaatcatagtgaaatcgaaaggcgcagacggaacaagatgact
cagtacatcacggagctctccgacatggtccccacatgcagcgcactggctcggaagcca
gacaagctcaccatcctccgcatggccgtctcgcacatgaagtccatgaggggtacaggg
aacaagtccaccgatggcgcgtacaagccttccttcctcacagagcaggaactgaagcat
ctcatccttgaagcagctgatggatttctgtttgtggtggctgctgagacagggcgagtg
atttatgtgtctgactccgtcacccctgttctgaaccagccccagtcagagtggtttggg
agcacactgtatgaacaggtgcatcctgatgacgtggagaagctgagagagcaactgtgc
acctcagaaaactcaatgacaggccggatcttggacctgaagactgggacggtcaagaaa
gaagggcagcagtcatccatgaggatgtgcatgggctcgcggcggtctttcatctgcagg
atgaggtgtggaaatgctcctttggaccaccttcctctaaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccaatatgctgtggtc
cactgtacaggatacatcaaggcctggccaccagcaggaatgaccatacctgaagaagac
gctgatgtgggacaaggcagtaaatattgcctcgtggcaattgggagactccaggtgacc
agctctcctgtatgcatggacatgaatgggatgtcggtgcccacagagttcttatcccgg
cataactccgatggaatcatcacatttgtggatccaagatgtatcagtgtgattggctac
caaccccaggatcttctgggaaaggacattttggaattctgccaccctgaggatcaaagc
catctgcgtgagagcttccagcaggtggttaagctgaaaggccaagtcctgtcggtcatg
tatcgatttcgcaccaagaaccgggagtggatgttgatccgcaccagcagcttcacattc
cagaatccctattctgatgagattgagtacatcatctgcaccaacaccaacgtcaagcaa
cttcagcaacagcaggcagaattggaagtgcaccagagagatggattgtcatcgtatgac
ttatcccaggtccccgtccccaacctaccagccggtgttcatgaggccgggaagtccgtg
gaaaaggcggatgcaatcttctcccaggaaagagatcctcggtttgctgaaatgtttgca
ggaattagtgcatcggagaagaagatgatgagctcagcctctgcagcaggaacccagcag
atctactcccaaggaagcccatttccctctggacactccgggaaggccttcagctcttca
gtggttcatgtgcctggagtgaatgatattcagtcctcttcttccacgggccagaacatg
tcccaaatctcccggcagctaaaccagagtcaggtggcatggacagggagtcgtccgccc
tttccgggacagcaaatcccatctcagtccagcaagactcagtcatctccctttgggatt
ggaacgagccacacctacccggcagacccctcttcctacagccccctctccagcccagct
acctcctcgccaagtgggaatgcctactccagtcttgccaacaggactccagggttcgct
gaaagtggacaaagtagcgggcagttccaagggcggccctcggaagtctggtcgcagtgg
caaagccagcaccatggccagcagagcggtgagcagcactcccaccagcagcccggtcag
actgaagtgttccaggacatgctgcccatgccaggagatccaacccaggggactggcaac
tataacatcgaagactttgccgacctgggcatgtttccaccgttttctgagtag

DBGET integrated database retrieval system