KEGG   Homo sapiens (human): 9918
Entry
9918              CDS       T01001                                 

Gene name
NCAPD2, CAP-D2, CNAP1, MCPH21, hCAP-D2
Definition
(RefSeq) non-SMC condensin I complex subunit D2
  KO
K06677  condensin complex subunit 1
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9918 (NCAPD2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    9918 (NCAPD2)
SSDB
Motif
Pfam: Cnd1 Cnd1_N Adaptin_N LrgA Proteasom_PSMB Cnd3 RMI1_N
Other DBs
NCBI-GeneID: 9918
NCBI-ProteinID: NP_055680
OMIM: 615638
HGNC: 24305
Ensembl: ENSG00000010292
Vega: OTTHUMG00000168513
Pharos: Q15021(Tbio)
UniProt: Q15021 B3KY03 B3KMS0
Position
12p13.31
AA seq 1401 aa
MAPQMYEFHLPLSPEELLKSGGVNQYVVQEVLSIKHLPPQLRAFQAAFRAQGPLAMLQHF
DTIYSILHHFRSIDPGLKEDTLQFLIKVVSRHSQELPAILDDTTLSGSDRNAHLNALKMN
CYALIRLLESFETMASQTNLVDLDLGGKGKKARTKAAHGFDWEEERQPILQLLTQLLQLD
IRHLWNHSIIEEEFVSLVTGCCYRLLENPTINHQKNRPTREAITHLLGVALTRYNHMLSA
TVKIIQMLQHFEHLAPVLVAAVSLWATDYGMKSIVGEIVREIGQKCPQELSRDPSGTKGF
AAFLTELAERVPAILMSSMCILLDHLDGENYMMRNAVLAAMAEMVLQVLSGDQLEAAARD
TRDQFLDTLQAHGHDVNSFVRSRVLQLFTRIVQQKALPLTRFQAVVALAVGRLADKSVLV
CKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWE
AMLPELKSTLQQLLQLPQGEEEIPEQIANTETTEDVKGRIYQLLAKASYKKAIILTREAT
GHFQESEPFSHIDPEESEETRLLNILGLIFKGPAASTQEKNPRESTGNMVTGQTVCKNKP
NMSDPEESRGNDELVKQEMLVQYLQDAYSFSRKITEAIGIISKMMYENTTTVVQEVIEFF
VMVFQFGVPQALFGVRRMLPLIWSKEPGVREAVLNAYRQLYLNPKGDSARAKAQALIQNL
SLLLVDASVGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGM
MARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRHPPFRLP
QEHRLFERLRETVTKGFVHPDPLWIPFKEVAVTLIYQLAEGPEVICAQILQGCAKQALEK
LEEKRTSQEDPKESPAMLPTFLLMNLLSLAGDVALQQLVHLEQAVSGELCRRRVLREEQE
HKTKDPKEKNTSSETTMEEELGLVGATADDTEAELIRGICEMELLDGKQTLAAFVPLLLK
VCNNPGLYSNPDLSAAASLALGKFCMISATFCDSQLRLLFTMLEKSPLPIVRSNLMVATG
DLAIRFPNLVDPWTPHLYARLRDPAQQVRKTAGLVMTHLILKDMVKVKGQVSEMAVLLID
PEPQIAALAKNFFNELSHKGNAIYNLLPDIISRLSDPELGVEEEPFHTIMKQLLSYITKD
KQTESLVEKLCQRFRTSRTERQQRDLAYCVSQLPLTERGLRKMLDNFDCFGDKLSDESIF
SAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPS
TGSRYQPLASTASDNDFVTPEPRRTTRRHPNTQQRASKKKPKVVFSSDESSEEDLSAEMT
EDETPKKTTPILRASARRHRS
NT seq 4206 nt   +upstreamnt  +downstreamnt
atggctccccaaatgtatgagttccatctgccattatccccagaggagttgttgaaaagt
ggaggggtgaatcagtatgttgtgcaagaggtactgtccatcaaacatcttccaccacag
cttagagcttttcaggctgcctttcgagctcaggggcccctggctatgctgcagcacttt
gatactatctacagcattttgcatcactttcgaagtatagatcctggcctcaaagaagat
actctgcaattcctgataaaagtggtatcccgccactcccaggagcttccagctatcctg
gatgatacaactttgagtggatcagatagaaacgcccatctaaatgccctcaaaatgaac
tgttatgctctgatacgtctcctggaatcctttgagaccatggccagccagacaaacctt
gtggacctggaccttggtgggaagggtaagaaagctcggaccaaggcagcccatggcttt
gactgggaagaagagaggcaaccaattcttcagcttttaacacagctacttcagttggac
atccgtcacctgtggaaccactcaataattgaagaagaatttgtcagtttggttactggc
tgttgctaccgccttctggagaatcccaccattaatcaccagaagaaccgccccactcgg
gaagccataacacacctgcttggtgtagccttgacccgttataaccatatgctcagtgct
acagtgaagatcatccagatgctgcagcactttgaacacctggcacctgtactggttgca
gccgtgagtctatgggcaactgactatggaatgaagagcatagtgggagagattgtaaga
gagattggacaaaagtgtccccaagagctgagtcgagacccttcagggacaaagggcttt
gcagcattcctgacagaactagcagaacgtgtcccagctatcctgatgtccagcatgtgc
attttgctagatcacctggatggagaaaattacatgatgcgtaatgctgtgctggcagcc
atggcggagatggtgctgcaggttctcagtggcgatcaactggaagcagcagcccgagac
accagagaccagttcttggatactttacaagcccatggccatgatgtcaactcctttgtg
cggagccgtgttttgcagctcttcacccgaattgtccagcagaaggctctccccctgaca
cgtttccaggcagtggtggctttagctgtgggacgtctggcagacaagtcagtgctagta
tgtaaaaatgccatccagctgctggccagttttctagccaataatcctttctcctgcaag
cttagtgatgctgaccttgccggaccactgcagaaggagacccagaaattacaagagatg
agggcccagaggcgaactgcagcagcttctgcagtgctggacccagaggaggagtgggaa
gccatgctgccagagttgaagtctaccctgcagcagcttctacagcttccccagggagag
gaggagattcctgagcaaattgccaatacagagacaactgaagatgtgaaaggacgcatc
tatcaactgcttgccaaagctagttacaaaaaggccatcattctcactcgagaagccaca
ggccacttccaggagtccgaacccttcagtcatatagacccagaggagtcagaggagacc
aggctcttgaatatcttaggacttatcttcaaaggcccagcagcttccacacaagaaaag
aatccccgggagtctacaggaaacatggtcacaggacagactgtctgtaaaaataaaccc
aatatgtcggatcctgaggaatccaggggaaatgatgaactagtgaagcaggagatgctg
gtacagtatctgcaggatgcctacagcttctcccggaagattacagaggccattggcatc
atcagcaagatgatgtatgaaaacacaactacagtggtgcaggaggtgattgaattcttt
gtgatggtcttccaatttggggtaccccaggccctgtttggggtgcgccgtatgctgcct
ctcatctggtctaaggagcctggtgtccgggaagccgtgcttaatgcctaccgccaactc
tacctcaaccccaaaggggactctgccagagccaaggcccaggctttgattcagaatctc
tctctgctgctagtggatgcctcggttgggaccattcagtgtcttgaggaaattctctgt
gagtttgtgcagaaggatgagttgaaaccagcagtgacccagctgctgtgggagcgggcc
accgagaaggtcgcctgctgtcctctggagcgctgttcctctgtcatgcttcttggcatg
atggcacgaggaaagccagaaattgtgggaagcaatttagacacactggtgagcataggg
ctggatgagaagtttccacaggactacaggctggcccagcaggtgtgccatgccattgcc
aacatctcggacaggagaaagccttctctgggcaaacgtcacccccccttccggctgcct
caggaacacaggttgtttgagcgactgcgggagacagtcacaaaaggctttgtccaccca
gacccactctggatcccattcaaagaggtggcagtgaccctcatttaccaactggcagag
ggccccgaagtgatctgtgcccagatattgcagggctgtgcaaaacaggccctggagaag
ctagaagagaagagaaccagtcaggaggacccgaaggagtcccccgcaatgctccccact
ttcctgttgatgaacctgctgtccctggctggggatgtggctctgcagcagctggtccac
ttggagcaggcagtgagtggagagctctgccggcgccgagttctccgggaagaacaggag
cacaagaccaaagatcccaaggagaagaatacgagctctgagaccaccatggaggaggag
ctggggctggttggggcaacagcagatgacacagaggcagaactaatccgtggcatctgc
gagatggaactgttggatggcaaacagacactggctgcctttgttccactcttgcttaaa
gtctgtaacaacccaggcctctatagcaacccagacctctctgcagctgcttcacttgcc
cttggcaagttctgcatgatcagtgccactttctgcgactcccagcttcgtcttctgttc
accatgctggaaaagtctccacttcccattgtccggtctaacctcatggttgccactggg
gatctggccatccgctttcccaatctggtggacccctggactcctcatctgtatgctcgt
ctccgggaccctgctcagcaagtgcggaaaacagcggggctggtgatgacccacctgatc
ctcaaggacatggtgaaggtgaaggggcaggtcagcgagatggcggtgctgctcatcgac
cccgagcctcagattgctgccctggccaagaacttcttcaatgagctctcccacaagggc
aacgcaatctataatctccttccagatatcatcagccgcctgtcagaccccgagctgggg
gtggaggaagagcctttccacaccatcatgaaacagctcctctcctacatcaccaaggac
aagcagacagagagcctggtggaaaagctgtgtcagcggttccgcacatcccgaactgag
cggcagcagcgagacctggcctactgtgtgtcacagctgcccctcacagagcgaggcctc
cgtaagatgcttgacaattttgactgttttggagacaaactgtcagatgagtccatcttc
agtgcttttttgtcagttgtaggcaagctgcgacgtggggccaagcctgagggcaaggct
ataatagatgaatttgagcagaagcttcgggcctgtcataccagaggtttggatggaatc
aaggagcttgagattggccaagcaggtagccagagagcgccatcagccaagaaaccatcc
actggttctaggtaccagcctctggcttctacagcctcagacaatgactttgtcacacca
gagccccgccgtactacccgtcggcatccaaacacccagcagcgagcttccaaaaagaaa
cccaaagttgtcttctcaagtgatgagtccagtgaggaagatctttcagcagagatgaca
gaagacgagacacccaagaaaacaactcccattctcagagcatcggctcgcaggcacaga
tcctag

DBGET integrated database retrieval system