KEGG   Homo sapiens (human): 9934Help
Entry
9934              CDS       T01001                                 

Gene name
P2RY14, BPR105, GPR105, P2Y14
Definition
(RefSeq) purinergic receptor P2Y14
  KO
K04299  P2Y purinoceptor 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9934 (P2RY14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9934 (P2RY14)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    9934 (P2RY14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx DUF948 DUF2615 DUF373
Motif
Other DBs
NCBI-GeneID: 9934
NCBI-ProteinID: NP_001074924
OMIM: 610116
HGNC: 16442
Ensembl: ENSG00000174944
Vega: OTTHUMG00000159859
Pharos: Q15391(Tbio)
UniProt: Q15391 A5JUU3
Position
3q25.1
AA seq 338 aa AA seqDB search
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcaacctccacacagcctccagatgaatcctgctctcagaacctcctgatc
actcagcagatcattcctgtgctgtactgtatggtcttcattgcaggaatcctactcaat
ggagtgtcaggatggatattcttttacgtgcccagctctaagagtttcatcatctatctc
aagaacattgttattgctgactttgtgatgagcctgacttttcctttcaagatccttggt
gactcaggccttggtccctggcagctgaacgtgtttgtgtgcagggtctctgccgtgctc
ttctacgtcaacatgtacgtcagcattgtgttctttgggctcatcagctttgacagatat
tataaaattgtaaagcctctttggacttctttcatccagtcagtgagttacagcaaactt
ctgtcagtgatagtatggatgctcatgctcctccttgctgttccaaatattattctcacc
aaccagagtgttagggaggttacacaaataaaatgtatagaactgaaaagtgaactggga
cggaagtggcacaaagcatcaaactacatcttcgtggccatcttctggattgtgtttctt
ttgttaatcgttttctatactgctatcacaaagaaaatctttaagtcccaccttaagtca
agtcggaattccacttcggtcaaaaagaaatctagccgcaacatattcagcatcgtgttt
gtgttttttgtctgttttgtaccttaccatattgccagaatcccctacacaaagagtcag
accgaagctcattacagctgccagtcaaaagaaatcttgcggtatatgaaagaattcact
ctgctactatctgctgcaaatgtatgcttggaccctattatttatttctttctatgccag
ccgtttagggaaatcttatgtaagaaattgcacattccattaaaagctcagaatgaccta
gacatttccagaatcaaaagaggaaatacaacacttgaaagcacagatactttgtga

DBGET integrated database retrieval system