KEGG   Homo sapiens (human): 994Help
Entry
994               CDS       T01001                                 

Gene name
CDC25B
Definition
(RefSeq) cell division cycle 25B
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04110  Cell cycle
hsa04914  Progesterone-mediated oocyte maturation
hsa05206  MicroRNAs in cancer
Module
hsa_M00691  DNA damage-induced cell cycle checkpoints
Network
N00455  CDC25-Cell cycle G2/M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    994 (CDC25B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    994 (CDC25B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    994 (CDC25B)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    994 (CDC25B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    994 (CDC25B)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    994 (CDC25B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     994 (CDC25B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    994 (CDC25B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    994 (CDC25B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 994
NCBI-ProteinID: NP_068659
OMIM: 116949
HGNC: 1726
Ensembl: ENSG00000101224
Vega: OTTHUMG00000031764
Pharos: P30305(Tchem)
UniProt: P30305 B3KS38 Q6MZW8
Structure
PDB: 

Position
20p13
AA seq 580 aa AA seqDB search
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgccccagccggagcccgcgccaggctcggctctcagtccagcaggcgtgtgc
ggtggcgcccagcgtccgggccacctcccgggcctcctgctgggatctcatggcctcctg
gggtccccggtgcgggcggccgcttcctcgccggtcaccaccctcacccagaccatgcac
gacctcgccgggctcggcagcgaaaccccaaagagtcaggtagggaccctgctcttccgc
agccgcagccgcctgacgcacctatccctgtctcgacgggcatccgaatcctccctgtcg
tctgaatcctccgaatcttctgatgcaggtctctgcatggattcccccagccctatggac
ccccacatggcggagcagacgtttgaacaggccatccaggcagccagccggatcattcga
aacgagcagtttgccatcagacgcttccagtctatgccggtgaggctgctgggccacagc
cccgtgcttcggaacatcaccaactcccaggcgcccgacggccggaggaagagcgaggcg
ggcagtggagctgccagcagctctggggaagacaaggagaatgatggatttgtcttcaag
atgccatggaagcccacacatcccagctccacccatgctctggcagagtgggccagccgc
agggaagcctttgcccagagacccagctcggcccccgacctgatgtgtctcagtcctgac
cggaagatggaagtggaggagctcagccccctggccctaggtcgcttctctctgacccct
gcagagggggatactgaggaagatgatggatttgtggacatcctagagagtgacttaaag
gatgatgatgcagttcccccaggcatggagagtctcattagtgccccactggtcaagacc
ttggaaaaggaagaggaaaaggacctcgtcatgtacagcaagtgccagcggctcttccgc
tctccgtccatgccctgcagcgtgatccggcccatcctcaagaggctggagcggccccag
gacagggacacgcccgtgcagaataagcggaggcggagcgtgacccctcctgaggagcag
caggaggctgaggaacctaaagcccgcgtcctccgctcaaaatcactgtgtcacgatgag
atcgagaacctcctggacagtgaccaccgagagctgattggagattactctaaggccttc
ctcctacagacagtagacggaaagcaccaagacctcaagtacatctcaccagaaacgatg
gtggccctattgacgggcaagttcagcaacatcgtggataagtttgtgattgtagactgc
agatacccctatgaatatgaaggcgggcacatcaagactgcggtgaacttgcccctggaa
cgcgacgccgagagcttcctactgaagagccccatcgcgccctgtagcctggacaagaga
gtcatcctcattttccactgtgaattctcatctgagcgtgggccccgcatgtgccgtttc
atcagggaacgagaccgtgctgtcaacgactaccccagcctctactaccctgagatgtat
atcctgaaaggcggctacaaggagttcttccctcagcacccgaacttctgtgaaccccag
gactaccggcccatgaaccacgaggccttcaaggatgagctaaagaccttccgcctcaag
actcgcagctgggctggggagcggagccggcgggagctctgtagccggctgcaggaccag
tga

DBGET integrated database retrieval system