KEGG   Homo sapiens (human): 9943Help
Entry
9943              CDS       T01001                                 

Gene name
OXSR1, OSR1
Definition
(RefSeq) oxidative stress responsive kinase 1
  KO
K08835  serine/threonine-protein kinase OSR1/STK39 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9943 (OXSR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9943 (OXSR1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   9943 (OXSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 9943
NCBI-ProteinID: NP_005100
OMIM: 604046
HGNC: 8508
Ensembl: ENSG00000172939
Vega: OTTHUMG00000131084
Pharos: O95747(Tbio)
UniProt: O95747 A0A024R2M7
Structure
PDB: 

Position
3p22.2
AA seq 527 aa AA seqDB search
MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDEL
LKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDE
STIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRN
KVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTL
QNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFL
QEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRSP
RVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLV
IVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggactcgagcgccctgccctggtccatcaacagggacgattacgagctgcag
gaggtgatcgggagtggagcaactgctgtagtccaagcagcttattgtgcccctaaaaag
gagaaagtggcaatcaaacggataaaccttgagaaatgtcaaactagcatggatgaactc
ctgaaagaaattcaagccatgagtcaatgccatcatcctaatattgtatcttactacaca
tcttttgtggtaaaagatgagctgtggcttgtcatgaagctgctaagtggaggttctgtt
ctggatattattaagcacattgtggcaaaaggggaacacaaaagtggagtcctagatgaa
tctaccattgctacgatactccgagaagtactggaagggctggaatatctgcataaaaat
ggacagatccacagagatgtgaaagctggaaacattcttcttggagaagatggctcagta
cagattgcagactttggggttagtgcttttttagcaactggtggtgatattacccgaaat
aaagtgagaaagacctttgttggcaccccttgttggatggcacctgaagttatggaacag
gtccgtggttatgatttcaaagctgatatttggagttttggaattacagcaattgaattg
gctacaggggcggctccttatcataaatatccaccaatgaaggttttaatgctgacactg
cagaacgatcctccttctttggaaactggtgttcaagataaagaaatgctgaaaaaatat
ggaaaatcatttagaaaaatgatttcattgtgccttcaaaaagatccagaaaaaagacca
acagcagcagaactattaaggcacaaatttttccagaaagcaaagaataaagaatttctt
caagaaaaaacattgcagagagcaccaaccatttctgaaagagcaaaaaaggttcggaga
gtaccaggttccagtgggcgtcttcataagacagaggatggaggctgggagtggagtgat
gatgaatttgatgaagaaagtgaggaagggaaagcagcaatttcacaactcaggtctccc
cgagtgaaagaatcaatatcaaattctgagctctttccaacaactgatcctgtgggtact
ttgctccaagttccagaacagatctctgctcatctacctcagccagctgggcagattgct
acacagccaactcaagtctctctcccacccaccgcagagccagcaaaaacagctcaggct
ttgtcttcaggatcaggttcacaagaaaccaagatcccaatcagtctagtactaagatta
aggaattccaaaaaagaactaaatgatattcgatttgaatttactcctgggagagataca
gcagagggtgtctctcaggaactcatttctgctggcctggtcgacggaagggatttagta
atagtggcagctaatttgcagaaaattgtggaagaacctcagtcaaatcgatctgtcact
ttcaaactggcatctggtgtcgaaggctcagatattcctgatgatggtaaactgatagga
tttgcccagctcagcatcagctaa

DBGET integrated database retrieval system