KEGG   Homo sapiens (human): 9948
Entry
9948              CDS       T01001                                 

Gene name
WDR1, AIP1, HEL-S-52, NORI-1, PFITS
Definition
(RefSeq) WD repeat domain 1
  KO
K24736  WD repeat-containing protein 1 (actin-interacting protein 1)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9948 (WDR1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   9948 (WDR1)
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 PQQ IKI3 BBS2_Mid
Other DBs
NCBI-GeneID: 9948
NCBI-ProteinID: NP_059830
OMIM: 604734
HGNC: 12754
Ensembl: ENSG00000071127
Vega: OTTHUMG00000160253
Pharos: O75083(Tbio)
UniProt: O75083 V9HWG7
Position
4p16.1
AA seq 606 aa
MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQ
VVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVV
GEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFK
FKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAI
SWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGY
INYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFA
GKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGY
AVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLK
DEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAW
SPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVK
EWTITY
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgccgtacgagatcaagaaggtgttcgccagcctcccgcaggtggagaggggcgtctcc
aagatcatcggcggcgaccctaagggcaacaattttctgtacaccaatggaaagtgcgtc
atcctaaggaacatcgacaacccagcccttgctgacatctacacagagcacgcccatcag
gtggtggtggccaagtatgcgcccagcggattctacattgcctccggagatgtgtctggg
aagctgaggatctgggataccacgcagaaggagcacctgttgaagtatgagtaccagcct
ttcgctgggaagatcaaagacattgcttggactgaagacagtaagaggatcgccgtggtc
ggggaaggaagggagaagtttggagcagtcttcctctgggatagtggctcttctgtgggc
gagattacaggacacaacaaagtcatcaacagcgtggacatcaagcagagccggccatac
cggctggccacgggaagcgatgataactgcgcggcattctttgagggacccccattcaag
ttcaagttcacaattggcgaccacagccgctttgtcaactgtgtgcgattctctcctgat
gggaacagatttgccacagccagtgctgacggccagatatacatctatgacgggaagact
ggggagaaggtgtgcgcgctgggcggaagcaaggcccacgacggtgggatttacgcaatt
agttggagtcccgacagcacccatttgctttctgcttctggggacaaaacttccaagatt
tgggacgtcagcgtgaactccgtggtcagcacatttcccatgggctccacggttctggac
cagcagctgggctgcctatggcagaaggaccacctgctcagtgtctccctgtccgggtac
atcaactatctggacagaaacaaccccagcaagcccctgcacgtcatcaagggtcacagt
aaatcgatccagtgtctgacggtgcataaaaacggcggcaagtcctacatttactctggg
agccacgacggacacattaattactgggattcagagacgggggagaacgactccttcgct
gggaaaggccacacgaaccaggtgtccaggatgaccgtggatgagtcggggcagctcatc
agctgcagcatggacgacaccgtgcggtacaccagcctcatgctgcgggactacagcgga
caaggagttgtgaaactggacgttcagccaaagtgcgtagccgtcggccccgggggatac
gccgtggtcgtgtgcattggacagattgtcctgctgaaggatcagaggaagtgcttcagc
atcgacaaccccggctacgagcccgaagttgtggcagtgcaccccggcggggacacggtg
gcaattgggggtgtggacggcaacgtccgcctgtattccatcctgggcaccacgctgaag
gatgagggcaagctcctagaggccaagggccccgtgaccgacgtggcctactcccacgac
ggcgccttcctcgcggtgtgcgacgccagcaaggtggtcacagtgttcagcgttgctgac
ggctactcggagaacaatgttttttatggacaccatgcaaaaatcgtctgcctggcctgg
tccccagacaatgaacactttgcctccggtggcatggacatgatggtgtatgtttggacc
ctgagtgacccggaaaccagagtcaagatccaagatgcacaccggctgcaccatgtcagc
agcctggcctggctggacgagcacacgctggtcacgacctcccatgatgcctctgtcaag
gagtggacaatcacctactga

DBGET integrated database retrieval system