KEGG   Homo sapiens (human): 9957Help
Entry
9957              CDS       T01001                                 

Gene name
HS3ST1, 3OST, 3OST1
Definition
(RefSeq) heparan sulfate-glucosamine 3-sulfotransferase 1
  KO
K01024  [heparan sulfate]-glucosamine 3-sulfotransferase 1 [EC:2.8.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    9957 (HS3ST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.23  [heparan sulfate]-glucosamine 3-sulfotransferase 1
     9957 (HS3ST1)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9957 (HS3ST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 9957
NCBI-ProteinID: NP_005105
OMIM: 603244
HGNC: 5194
Ensembl: ENSG00000002587
Vega: OTTHUMG00000090547
Pharos: O14792(Tbio)
UniProt: O14792 A0A024R9R4
Structure
PDB: 

Position
4p15.33
AA seq 307 aa AA seqDB search
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIII
GVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKT
PAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVR
DGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQ
INASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
GRTFDWH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctgctcctgggcgcggtgctgctggtggcccagccccagctagtgccttcc
cgccccgccgagctaggccagcaggagcttctgcggaaagcggggaccctccaggatgac
gtccgcgatggcgtggccccaaacggctctgcccagcagttgccgcagaccatcatcatc
ggcgtgcgcaagggcggcacgcgcgcactgctggagatgctcagcctgcaccccgacgtg
gcggccgcggagaacgaggtccacttcttcgactgggaggagcattacagccacggcttg
ggctggtacctcagccagatgcccttctcctggccacaccagctcacagtggagaagacc
cccgcgtatttcacgtcgcccaaagtgcctgagcgagtctacagcatgaacccgtccatc
cggctgctgctcatcctgcgagacccgtcggagcgcgtgctatctgactacacccaagtg
ttctacaaccacatgcagaagcacaagccctacccgtccatcgaggagttcctggtgcgc
gatggcaggctcaatgtggactacaaggccctcaaccgcagcctctaccacgtgcacatg
cagaactggctgcgctttttcccgctgcgccacatccacattgtggacggcgaccgcctc
atcagggaccccttccctgagatccaaaaggtcgagaggttcctaaagctgtcgccgcag
atcaatgcttcgaacttctactttaacaaaaccaagggcttttactgcctgcgggacagc
ggccgggaccgctgcttacatgagtccaaaggccgggcgcacccccaagtcgatcccaaa
ctactcaataaactgcacgaatattttcatgagccaaataagaagttcttcgagcttgtt
ggcagaacatttgactggcactga

DBGET integrated database retrieval system