KEGG   Homo sapiens (human): 996Help
Entry
996               CDS       T01001                                 

Gene name
CDC27, ANAPC3, APC3, CDC27Hs, D0S1430E, D17S978E, H-NUC, HNUC, NUC2
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Module
hsa_M00389  APC/C complex
Network
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    996 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    996 (CDC27)
   04114 Oocyte meiosis
    996 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    996 (CDC27)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    996 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    996 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    996 (CDC27)
   03036 Chromosome and associated proteins [BR:hsa03036]
    996 (CDC27)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     996 (CDC27)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     996 (CDC27)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    996 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_19 TPR_16 TPR_14 TPR_6 TPR_9 ChAPs TPR_MalT TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 996
NCBI-ProteinID: NP_001247
OMIM: 116946
HGNC: 1728
Ensembl: ENSG00000004897
Vega: OTTHUMG00000166429
Pharos: P30260(Tbio)
UniProt: P30260
Structure
PDB: 

Position
17q21.32
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTP
QVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgcctttatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcaatgcaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctg
cccaactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcacctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagcagctcttagtccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacacctcctgtaattgatgtgccatccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagccga
gaggtaactccaattcttgcacaaacacaaagttctggtccacaaacaagtacaacacct
caggtattgagccccactattacatctcccccaaacgcactgcctcgaagaagttcacga
ctctttactagtgacagctccacaaccaaggagaatagcaaaaaattaaaaatgaagttt
ccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataactcaa
cctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaaggg
aaaatatccacaatcacacctcagattcaggcctttaatctacaaaaagcagcagcagaa
ggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattttgagccatctaccttctcaccactacaatactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactct
acaacactttggcatcttcaaaaagatgttgctctttcagttctgtcaaaagacttaaca
gacatggataaaaattcgccagaggcctggtgtgctgcagggaactgtttcagtctgcaa
cgggaacatgatattgcaattaaattcttccagagagctatccaagttgatccaaattac
gcttatgcctatactctattagggcatgagtttgtcttaactgaagaattggacaaagca
ttagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtatggt
ttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccaaaaa
gcgcttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcaacat
gcactgaaaaaatcagagaaggctttggataccctaaacaaagccattgtcattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aagcgttatcttccagatgatgaggagccaataacccaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcggatgacacacaacttcatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system