KEGG   Homo sapiens (human): 9961Help
Entry
9961              CDS       T01001                                 

Gene name
MVP, LRP, VAULT1
Definition
(RefSeq) major vault protein
  KO
K17266  major vault protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9961 (MVP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9961 (MVP)
  Exosomal proteins of breast milk
   9961 (MVP)
  Exosomal proteins of bladder cancer cells
   9961 (MVP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vault MVP_shoulder Vault_2 Vault_3 Vault_4 DUF2543
Motif
Other DBs
NCBI-GeneID: 9961
NCBI-ProteinID: NP_005106
OMIM: 605088
HGNC: 7531
Ensembl: ENSG00000013364
Vega: OTTHUMG00000048227
Pharos: Q14764(Tbio)
UniProt: Q14764 X5D2M8
Structure
PDB: 

Position
16p11.2
AA seq 893 aa AA seqDB search
MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCT
VANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTA
LHLKALLDFEDKDGDKVVAGDEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARK
ECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRG
VSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKR
VVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIR
GPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELP
PGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARV
VFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQ
LAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIR
TAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQL
AIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTG
TAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVYARAQLELE
VSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPIN
LFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaagagttcatcatccgcatccccccataccactatatccatgtgctggac
cagaacagcaacgtgtcccgtgtggaggtcgggccaaagacctacatccggcaggacaat
gagagggtactgtttgcccccatgcgcatggtgaccgtccccccacgtcactactgcaca
gtggccaaccctgtgtctcgggatgcccagggcttggtgctgtttgatgtcacagggcaa
gttcggcttcgccacgctgacctcgagatccggctggcccaggaccccttccccctgtac
ccaggggaggtgctggaaaaggacatcacacccctgcaggtggttctgcccaacactgcc
ctccatctaaaggcgctgcttgattttgaggataaagatggagacaaggtggtggcagga
gatgagtggcttttcgagggacctggcacgtacatcccccggaaggaagtggaggtcgtg
gagatcattcaggccaccatcatcaggcagaaccaggctctgcggctcagggcccgcaag
gagtgctgggaccgggacggcaaggagagggtgacaggggaagaatggctggtcaccaca
gtaggggcgtacctcccagcggtgtttgaggaggttctggatttggtggacgccgtcatc
cttacggaaaagacagccctgcacctccgggctcggcggaacttccgggacttcagggga
gtgtcccgccgcactggggaggagtggctggtaacagtgcaggacacagaggcccacgtg
ccagatgtccacgaggaggtgctgggggttgtgcccatcaccaccctgggcccccacaac
tactgcgtgattctcgaccctgtcggaccggatggcaagaatcagctggggcagaagcgc
gtggtcaagggagagaagtcttttttcctccagccaggagagcagctggaacaaggcatc
caggatgtgtatgtgctgtcggagcagcaggggctgctgctgagggccctgcagcccctg
gaggagggggaggatgaggagaaggtctcacaccaggctggggaccactggctcatccgc
ggacccctggagtatgtgccatctgccaaagtggaggtggtggaggagcgccaggccatc
cctctagacgagaacgagggcatctatgtgcaggatgtcaagaccggaaaggtgcgcgct
gtgattggaagcacctacatgctgacccaggacgaagtcctgtgggagaaagagctgcct
cccggggtggaggagctgctgaacaaggggcaggaccctctggcagacaggggtgagaag
gacacagctaagagcctccagcccttggcgccccggaacaagacccgtgtggtcagctac
cgcgtgccccacaacgctgcggtgcaggtgtacgactaccgagagaagcgagcccgcgtg
gtcttcgggcctgagctggtgtcgctgggtcctgaggagcagttcacagtgttgtccctc
tcagctgggcggcccaagcgtccccatgcccgccgtgcgctctgcctgctgctggggcct
gacttcttcacagacgtcatcaccatcgaaacggcggatcatgccaggctgcaactgcag
ctggcctacaactggcactttgaggtgaatgaccggaaggacccccaagagacggccaag
ctcttttcagtgccagactttgtaggtgatgcctgcaaagccatcgcatcccgggtgcgg
ggggccgtggcctctgtcactttcgatgacttccataagaactcagcccgcatcattcgc
actgctgtctttggctttgagacctcggaagcgaagggccccgatggcatggccctgccc
aggccccgggaccaggctgtcttcccccaaaacgggctggtggtcagcagtgtggacgtg
cagtcagtggagcctgtggatcagaggacccgggacgccctgcaacgcagcgtccagctg
gccatcgagatcaccaccaactcccaggaagcggcggccaagcatgaggctcagagactg
gagcaggaagcccgcggccggcttgagcggcagaagatcctggaccagtcagaagccgag
aaagctcgcaaggaacttttggagctggaggctctgagcatggccgtggagagcaccggg
actgccaaggcggaggccgagtcccgtgcggaggcagcccggattgagggagaagggtcc
gtgctgcaggccaagctaaaagcacaggccttggccattgaaacggaggctgagctccag
agggtccagaaggtccgagagctggaactggtctatgcccgggcccagctggagctggag
gtgagcaaggctcagcagctggctgaggtggaggtgaagaagttcaagcagatgacagag
gccataggccccagcaccatcagggaccttgctgtggctgggcctgagatgcaggtaaaa
ctgctccagtccctgggcctgaaatcaaccctcatcaccgatggctccactcccatcaac
ctcttcaacacagcctttgggctgctggggatggggcccgagggtcagcccctgggcaga
agggtggccagtgggcccagccctggggaggggatatccccccagtctgctcaggcccct
caagctcctggagacaaccacgtggtgcctgtactgcgctaa

DBGET integrated database retrieval system