KEGG   Homo sapiens (human): 9966Help
Entry
9966              CDS       T01001                                 

Gene name
TNFSF15, TL1, TL1A, TNLG1B, VEGI, VEGI192A
Definition
(RefSeq) TNF superfamily member 15
  KO
K05478  tumor necrosis factor ligand superfamily member 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00286  Crohn disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9966 (TNFSF15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9966 (TNFSF15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   9966 (TNFSF15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 9966
NCBI-ProteinID: NP_005109
OMIM: 604052
HGNC: 11931
Ensembl: ENSG00000181634
Vega: OTTHUMG00000021011
Pharos: O95150(Tbio)
UniProt: O95150 A0A0U5JA19
Structure
PDB: 

Position
9q32
AA seq 251 aa AA seqDB search
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctgggactgagctttggggaaacagccagtgtggaaatgctgccagag
cacggcagctgcaggcccaaggccaggagcagcagcgcacgctgggctctcacctgctgc
ctggtgttgctccccttccttgcaggactcaccacatacctgcttgtcagccagctccgg
gcccagggagaggcctgtgtgcagttccaggctctaaaaggacaggagtttgcaccttca
catcagcaagtttatgcacctcttagagcagacggagataagccaagggcacacctgaca
gttgtgagacaaactcccacacagcactttaaaaatcagttcccagctctgcactgggaa
catgaactaggcctggccttcaccaagaaccgaatgaactataccaacaaattcctgctg
atcccagagtcgggagactacttcatttactcccaggtcacattccgtgggatgacctct
gagtgcagtgaaatcagacaagcaggccgaccaaacaagccagactccatcactgtggtc
atcaccaaggtaacagacagctaccctgagccaacccagctcctcatggggaccaagtct
gtatgcgaagtaggtagcaactggttccagcccatctacctcggagccatgttctccttg
caagaaggggacaagctaatggtgaacgtcagtgacatctctttggtggattacacaaaa
gaagataaaaccttctttggagccttcttactatag

DBGET integrated database retrieval system