KEGG   Homo sapiens (human): 9970
Entry
9970              CDS       T01001                                 
Symbol
NR1I3, CAR, CAR1, MB67
Name
(RefSeq) nuclear receptor subfamily 1 group I member 3
  KO
K08541  constitutive androstane receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    9970 (NR1I3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9970 (NR1I3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    9970 (NR1I3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    9970 (NR1I3)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   9970 (NR1I3)
SSDB
Motif
Pfam: zf-C4 Hormone_recep PAPA-1 YdjO
Other DBs
NCBI-GeneID: 9970
NCBI-ProteinID: NP_001070948
OMIM: 603881
HGNC: 7969
Ensembl: ENSG00000143257
UniProt: Q14994
Structure
Position
1:complement(161229669..161238203)
AA seq 352 aa
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQR
RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGA
HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLP
VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQV
EFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI
KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccagtagggaagatgagctgaggaactgtgtggtatgtggggaccaagccacaggc
taccactttaatgcgctgacttgtgagggctgcaagggtttcttcaggagaacagtcagc
aaaagcattggtcccacctgcccctttgctggaagctgtgaagtcagcaagactcagagg
cgccactgcccagcctgcaggttgcagaagtgcttagatgctggcatgaggaaagacatg
atactgtcggcagaagccctggcattgcggcgagcaaagcaggcccagcggcgggcacag
caaacacctgtgcaactgagtaaggagcaagaagagctgatccggacactcctgggggcc
cacacccgccacatgggcaccatgtttgaacagtttgtgcagtttaggcctccagctcat
ctgttcatccatcaccagcccttgcccaccctggcccctgtgctgcctctggtcacacac
ttcgcagacatcaacactttcatggtactgcaagtcatcaagtttactaaggacctgccc
gtcttccgttccctgcccattgaagaccagatctcccttctcaagggagcagctgtggaa
atctgtcacatcgtactcaataccactttctgtctccaaacacaaaacttcctctgcggg
cctcttcgctacacaattgaagatggagcccgtgtatctcccacagtggggttccaggta
gagtttttggagttgctctttcacttccatggaacactacgaaaactgcagctccaagag
cctgagtatgtgctcttggctgccatggccctcttctctcctgaccgacctggagttacc
cagagagatgagattgatcagctgcaagaggagatggcactgactctgcaaagctacatc
aagggccagcagcgaaggccccgggatcggtttctgtatgcgaagttgctaggcctgctg
gctgagctccggagcattaatgaggcctacgggtaccaaatccagcacatccagggcctg
tctgccatgatgccgctgctccaggagatctgcagctga

DBGET integrated database retrieval system