KEGG   Homo sapiens (human): 9971Help
Entry
9971              CDS       T01001                                 

Gene name
NR1H4, BAR, FXR, HRR-1, HRR1, PFIC5, RIP14
Definition
(RefSeq) nuclear receptor subfamily 1 group H member 4
  KO
K08537  farnesoid X receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Drug target
Chenodeoxycholic acid: D00163
Cholic acid: D10699
Obeticholic acid: D09360
Turofexorate isopropyl: D08277
Ursodeoxycholic acid: D00734
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    9971 (NR1H4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9971 (NR1H4)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    9971 (NR1H4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    9971 (NR1H4)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   9971 (NR1H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 9971
NCBI-ProteinID: NP_001193922
OMIM: 603826
HGNC: 7967
Ensembl: ENSG00000012504
Vega: OTTHUMG00000170359
Pharos: Q96RI1(Tclin)
UniProt: Q96RI1
Structure
PDB: 

Position
12q23.1
AA seq 486 aa AA seqDB search
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEG
RDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgcagtttcaggggttagaaaatccaattcaaattagtcctcactgcagctgt
acgccgtcaggatttttcatggaaatgatgagtatgaagcccgcgaaaggtgttttaaca
gaacaagtggcaggtcctctgggacagaacctggaagtggaaccatactcgcaatacagc
aatgttcagtttccccaagttcaaccacagatttcctcgtcatcctattattccaacctg
ggtttctacccccagcagcctgaagagtggtactctcctggaatatatgaactcaggcgt
atgccagctgagactctctaccagggagaaactgaggtagcagagatgcctgtaacaaag
aagccccgcatgggcgcgtcagcagggaggatcaaaggggatgagctgtgtgttgtttgt
ggagacagagcctctggataccactataatgcactgacctgtgaggggtgtaaaggtttc
ttcaggagaagcattaccaaaaacgctgtgtacaagtgtaaaaacgggggcaactgtgtg
atggatatgtacatgcgaagaaagtgtcaagagtgtcgactaaggaaatgcaaagagatg
ggaatgttggctgaatgtatgtatacaggcttgttaactgaaattcagtgtaaatctaag
cgactgagaaaaaatgtgaagcagcatgcagatcagaccgtgaatgaagacagtgaaggt
cgtgacttgcgacaagtgacctcgacaacaaagtcatgcagggagaaaactgaactcacc
ccagatcaacagactcttctacattttattatggattcatataacaaacagaggatgcct
caggaaataacaaataaaattttaaaagaagaattcagtgcagaagaaaattttctcatt
ttgacggaaatggcaaccaatcatgtacaggttcttgtagaattcacaaaaaagctacca
ggatttcagactttggaccatgaagaccagattgctttgctgaaagggtctgcggttgaa
gctatgttccttcgttcagctgagattttcaataagaaacttccgtctgggcattctgac
ctattggaagaaagaattcgaaatagtggtatctctgatgaatatataacacctatgttt
agtttttataaaagtattggggaactgaaaatgactcaagaggagtatgctctgcttaca
gcaattgttatcctgtctccagatagacaatacataaaggatagagaggcagtagagaag
cttcaggagccacttcttgatgtgctacaaaagttgtgtaagattcaccagcctgaaaat
cctcaacactttgcctgtctcctgggtcgcctgactgaattacggacattcaatcatcac
cacgctgagatgctgatgtcatggagagtaaacgaccacaagtttaccccacttctctgt
gaaatctgggacgtgcagtga

DBGET integrated database retrieval system