KEGG   Homo sapiens (human): 9972
Entry
9972              CDS       T01001                                 

Gene name
NUP153, HNUP153, N153
Definition
(RefSeq) nucleoporin 153
  KO
K14296  nuclear pore complex protein Nup153
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    9972 (NUP153)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    9972 (NUP153)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9972 (NUP153)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9972 (NUP153)
SSDB
Motif
Pfam: Nup153 zf-RanBP Nup_retrotrp_bd HTH_IclR
Other DBs
NCBI-GeneID: 9972
NCBI-ProteinID: NP_005115
OMIM: 603948
HGNC: 8062
Ensembl: ENSG00000124789
Vega: OTTHUMG00000014312
Pharos: P49790(Tbio)
UniProt: P49790
Structure
PDB: 

Position
6p22.3
AA seq 1475 aa
MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFN
KNEDVCSCSTDTSEVPRWPENKEDHLVYADEESSNITDGRITPEPAVSNTEEPSTTSTAS
NYPDVLTRPSLHRSHLNFSMLESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDN
ISTTSGFSSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLS
PSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTPYQAPVRRQMKAKQLSAQS
YGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDFQAKREKVDSQ
YPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQ
RESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPIT
SSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSPSSTGSPMFKFSSPIVKSTEANVL
PPSSIGFTFSVPVAKTAELSGSSSTLEPIISSSAHHVTTVNSTNCKKTPPEDCEGPFRPA
EILKEGSVLDILKSPGFASPKIDSVAAQPTATSPVVYTRPAISSFSSSGIGFGESLKAGS
SWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFK
PVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVT
TGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSG
GSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDTSSSSSNSAAS
SSFKFGVSSSSSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFK
FGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSA
GFSFGTGVINSTPAPANTIVTSENKSSFNLGTIETKSASVAPFTCKTSEAKKEEMPATKG
GFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQ
TKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSS
STPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKL
ATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFG
ANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQ
SAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQ
SPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK
NT seq 4428 nt   +upstreamnt  +downstreamnt
atggcctcgggagccggaggagtcggagggggcggtggcggcaagatccggacgcggcgt
tgccaccaggggccaattaagccttaccagcaggggcgacaacagcatcagggcattctt
agcagggttacagaatctgttaagaatattgtgccagggtggctacaaagatacttcaac
aagaatgaagatgtatgcagctgttcaacagacacaagcgaggttccacgctggccagaa
aataaagaggaccatctggtatatgccgatgaggagagctctaatattactgatgggaga
atcacacctgagccagcagtcagtaatacagaagaaccttcaacaactagtactgcttca
aattatccagatgtgttaacaaggccttctcttcatcggagccatctgaatttttccatg
ttggaatcccctgcattacactgtcagccatctacatcctcggcattcccaattggcagt
tcgggattttcccttgtaaaggaaattaaagattctacctctcagcatgatgatgataac
atctcaactaccagtggtttttcttcaagagcttctgataaagatataactgtttcaaag
aacacttcattgccacctctgtggtccccagaagctgaacgttctcactcactctcacag
cacactgccaccagctcaaaaaaaccagcattcaacttgtctgcctttggaacactttcc
ccttcacttgggaattcttcaatccttaaaaccagtcagcttggagattctcctttttat
cctggaaaaacaacatacggtggggcagcagctgctgtaagacagtctaaactacgaaat
acaccttatcaggcaccagttagaagacaaatgaaagctaagcaactcagtgcacaatct
tacggtgtgaccagttcaacagctcggcgaatattgcagtctttagagaagatgtcaagc
cctttagcggatgcaaaaagaattccatccattgtttcttctcctctgaattctcctctt
gataggagtgggatagatatcacagattttcaggccaaaagagaaaaggtggattctcaa
tatcctcctgttcagagacttatgaccccaaagccagtttccatagcaacaaatcgaagt
gtttattttaaaccatctctgactccttctggtgaattcaggaagactaatcaaagaata
gataacaagtgcagtactggatatgaaaaaaatatgacacccggacaaaatagagaacaa
cgagaaagtggcttttcatatccaaatttcagtttgcctgcagccaatggtttatcttct
ggagtaggtggtggaggtggcaagatgagacgagaaagaacacgctttgttgcttctaaa
cctctggaggaggaggaaatggaagttccagtattaccgaaaatctctctaccgatcacc
agttcttcactgcctacctttaattttagttcccctgagatcacaacttcctctccatca
cccatcaattcgtctcaagcattaacaaacaaggtacaaatgacctctccgagcagcact
ggcagtcccatgtttaaattttcatctccaatcgtaaaatctactgaggcaaatgtacta
cctccatcatctattggatttacatttagtgtgcctgttgcaaaaacagcagaactttct
ggttctagtagtactttagaaccaattataagtagttcagctcatcatgtcactacagtg
aacagtacaaattgtaagaagacaccacctgaagattgtgagggtccttttagacctgca
gaaatcctgaaagaaggaagtgttctagatattctgaaaagccctggtttcgcatcgccg
aagatagattctgttgctgctcagcccaccgcaacaagcccagtagtttatacaagacca
gcaataagtagcttttcttctagtggaattgggtttggggagagtttaaaagctgggtca
tcatggcagtgtgatacatgtctactccagaacaaagttacagacaacaaatgcatagcc
tgtcaagcagcaaaattgtcacccagagatactgctaaacagactggaattgaaacacca
aataaaagtggcaaaacaactctttctgcatcagggacaggctttggagacaaatttaaa
ccagtgataggcacttgggattgtgatacctgtttagtgcaaaataaacctgaagcaata
aaatgtgtagcctgtgaaacaccgaaacctggaacttgtgtgaagcgagcccttacattg
acagtggtttcggaaagtgctgagactatgactgcttcatcttccagctgcactgtaacc
actggtaccttaggatttggagataaattcaaaaggcccattggatcttgggagtgttca
gtatgctgtgtttctaataatgcagaagacaataagtgtgtgtcctgtatgtctgagaaa
ccaggaagttcagtacctgcttcaagtagcagcactgtacctgtctctctgccttctgga
ggctctctaggattggaaaagttcaagaaacccgagggaagctgggactgtgaattgtgc
ctagtgcagaataaggcagactctaccaaatgtttggcatgtgaaagtgcaaagccaggc
acaaaatctgggtttaaaggctttgacacatcttcctcatcttcgaactcagcagcctcc
tcatccttcaaatttggtgtctcatcatcctcttctgggccttctcagactttaacaagc
actggaaattttaaatttggagatcagggaggattcaaaataggtgtgtcatccgattct
gggtctataaaccccatgagtgaaggctttaaattttctaaaccaataggagattttaaa
tttggagtttcatctgaatctaagcccgaagaagttaaaaaagatagtaagaatgataat
tttaagtttggactttcttctggtttaagcaacccagtttctttaactccatttcaattt
ggggtatctaatcttggacaggaagaaaagaaagaggaactgcccaaatcttcctctgca
ggttttagctttggtacaggtgttattaactccacccctgctcctgctaacaccatagtg
acctctgagaacaagagcagcttcaaccttggaaccatagaaaccaagagtgcttcagtg
gctcctttcacatgtaagacatcagaagctaaaaaagaagaaatgcctgccaccaaagga
ggattctcttttggcaacgtggagcctgcctctctgccatctgcctcagtgtttgttttg
ggaaggacagaagagaaacagcaagagcctgtcacttctacttccctagtttttgggaag
aaagctgacaatgaagagccaaagtgtcaaccagtgttttcctttgggaattcagagcaa
accaaagatgagaattcttcaaagtccacatttagttttagtatgacaaaaccatctgag
aaggaatctgaacagccagcaaaagccacttttgcctttggagctcaaactagtactaca
gctgatcaaggtgcagcaaagccagtttttagtttcttgaacaacagttcctctagttca
agtacaccagccacttctgctggtggtggcatatttggtagttccacctcttcctccaat
ccacctgtggctacctttgtgtttggacagtccagcaatcctgtgagcagctctgccttt
ggtaacactgctgaatccagcacctctcagtctttgctattttctcaagatagcaaacta
gcaaccacatccagcacaggtacagctgtcaccccatttgtctttggtccaggagccagc
agtaataatactaccacctctggtttcggctttggagccacaaccacatctagctctgca
ggatcctcctttgtatttggaactggaccctcagcaccatctgccagtccagcatttggt
gctaaccagaccccaacatttggacaaagtcaaggtgccagccagcccaatcccccaggc
tttggatctatatcatcttccacagcattatttcccactggttctcagcctgcaccacct
acttttgggacagtgtcaagcagtagccagccccctgtgtttggacagcaacctagtcag
tctgcatttggctctggaacaactcctaattctagttcggctttccagtttggcagcagc
actacaaatttcaacttcacaaacaacagtccatcaggagtgttcacatttggtgcaaat
tctagcacacctgcagcctcagcccagccttcaggctcggggggctttccatttaaccag
tctccagcagcatttacagtggggtcaaatgggaaaaatgtgttctcttcttctggaact
tcattctctggtcgcaagataaagactgctgttagacgcaggaaataa

DBGET integrated database retrieval system