KEGG   Homo sapiens (human): 9973
Entry
9973              CDS       T01001                                 

Gene name
CCS
Definition
(RefSeq) copper chaperone for superoxide dismutase
  KO
K04569  copper chaperone for superoxide dismutase
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    9973 (CCS)
   05022 Pathways of neurodegeneration - multiple diseases
    9973 (CCS)
SSDB
Motif
Pfam: Sod_Cu HMA
Other DBs
NCBI-GeneID: 9973
NCBI-ProteinID: NP_005116
OMIM: 603864
HGNC: 1613
Ensembl: ENSG00000173992
Vega: OTTHUMG00000167238
Pharos: O14618(Tbio)
UniProt: O14618
Structure
PDB: 

Position
11q13.2
AA seq 274 aa
MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQ
EVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTID
GLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAI
FRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNP
KQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcttcggattcggggaaccaggggaccctctgcacgttggagttcgcggtgcagatg
acctgtcagagctgtgtggacgcggtgcgcaaatccctgcaaggggtggcaggtgtccag
gatgtggaggtgcacttggaggaccagatggtcttggtacacaccactctacccagccag
gaggtgcaggctctcctggaaggcacggggcggcaggcggtactcaagggcatgggcagc
ggccagttgcagaatctgggggcagcagtggccatcctgggggggcctggcaccgtgcag
ggggtggtgcgcttcctacagctgacccctgagcgctgcctcatcgagggaactattgac
ggcctggagcctgggctgcatggactccacgtccatcagtacggggaccttacaaacaac
tgcaacagctgtgggaatcactttaaccctgatggagcatctcatgggggcccccaggac
tctgaccggcaccgcggagacctgggcaatgtccgtgctgatgctgacggccgcgccatc
ttcagaatggaggatgagcagctgaaggtgtgggatgtgattggccgcagcctgattatt
gatgagggagaagatgacctgggccggggaggccatcccttatccaagatcacagggaac
tccggggagaggttggcctgtggcatcattgcacgctccgctggccttttccagaacccc
aagcagatctgctcttgcgatggcctcaccatctgggaggagcgaggccggcccatcgct
ggcaagggccgaaaggagtcagcgcagccccctgcccacctttga

DBGET integrated database retrieval system