KEGG   Homo sapiens (human): 9975Help
Entry
9975              CDS       T01001                                 

Gene name
NR1D2, BD73, EAR-1R, REVERBB, REVERBbeta, RVR
Definition
(RefSeq) nuclear receptor subfamily 1 group D member 2
  KO
K08531  nuclear receptor subfamily 1 group D member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9975 (NR1D2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    9975 (NR1D2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    9975 (NR1D2)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   9975 (NR1D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep LpxD
Motif
Other DBs
NCBI-GeneID: 9975
NCBI-ProteinID: NP_005117
OMIM: 602304
HGNC: 7963
Ensembl: ENSG00000174738
Vega: OTTHUMG00000155659
Pharos: Q14995(Tbio)
UniProt: Q14995 F1D8P2
Structure
PDB: 

Position
3p24.2
AA seq 579 aa AA seqDB search
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL
ANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKS
SSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG
DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLI
MKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaatgcaggaggtgtgattgcctatatcagttcttccagctcagcctcaagc
cctgcctcttgtcacagtgagggttctgagaatagtttccagtcctcctcctcttctgtt
ccatcttctccaaatagctctaattctgataccaatggtaatcccaagaatggtgatctc
gccaatattgaaggcatcttgaagaatgatcgaatagattgttctatgaaaacaagcaaa
tcgagtgcacctgggatgacaaaaagtcatagtggtgtgacaaaatttagtggcatggtt
ctactgtgtaaagtctgtggggatgtggcgtcaggattccactatggagttcatgcttgc
gaaggctgtaagggtttctttcggagaagtattcaacaaaacatccagtacaagaagtgc
ctgaagaatgaaaactgttctataatgagaatgaataggaacagatgtcagcaatgtcgc
ttcaaaaagtgtctgtctgttggaatgtcaagagatgctgttcggtttggtcgtattcct
aagcgtgaaaaacagaggatgctaattgaaatgcaaagtgcaatgaagaccatgatgaac
agccagttcagtggtcacttgcaaaatgacacattagtagaacatcatgaacagacagcc
ttgccagcccaggaacagctgcgacccaagccccaactggagcaagaaaacatcaaaagc
tcttctcctccatcttctgattttgcaaaggaagaagtgattggcatggtgaccagagct
cacaaggatacctttatgtataatcaagagcagcaagaaaactcagctgagagcatgcag
ccccagagaggagaacggattcccaagaacatggagcaatataatttaaatcatgatcat
tgcggcaatgggcttagcagccattttccctgtagtgagagccagcagcatctcaatgga
cagttcaaagggaggaatataatgcattacccaaatggtcatgccatttgtattgcaaat
ggacattgtatgaacttctccaatgcttatactcaaagagtatgtgatagagttccgata
gatggattttctcagaatgagaacaagaatagttacctgtgcaacactggaggaagaatg
catctggtttgtccaatgagtaagtctccatatgtggatcctcataaatcaggacatgaa
atctgggaagaattttcgatgagcttcactccagcagtgaaagaagtggtggaatttgca
aagcgtattcctgggttcagagatctctctcagcatgaccaggtcaaccttttaaaggct
gggacttttgaggttttaatggtacggttcgcatcattatttgatgcaaaggaacgtact
gtcacctttttaagtggaaagaaatatagtgtggatgatttacactcaatgggagcaggg
gatctgctaaactctatgtttgaatttagtgagaagctaaatgccctccaacttagtgat
gaagagatgagtttgtttacagctgttgtcctggtatctgcagatcgatctggaatagaa
aacgtcaactctgtggaggctttgcaggaaactctcattcgtgcactaaggaccttaata
atgaaaaaccatccaaatgaggcctctatttttacaaaactgcttctaaagttgccagat
cttcgatctttaaacaacatgcactctgaggagctcttggcctttaaagttcacccttaa

DBGET integrated database retrieval system