KEGG   Homo sapiens (human): 9978Help
Entry
9978              CDS       T01001                                 

Gene name
RBX1, BA554C12.1, RNF75, ROC1
Definition
(RefSeq) ring-box 1
  KO
K03868  RING-box protein 1 [EC:2.3.2.32]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04066  HIF-1 signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Module
hsa_M00380  SCF-BTRC complex
hsa_M00381  SCF-SKP2 complex
hsa_M00382  SCF-FBS complex
hsa_M00383  ECV complex
hsa_M00384  Cul3-SPOP complex
hsa_M00385  Cul4-DDB1-DDB2 complex
hsa_M00386  Cul4-DDB1-CSA complex
hsa_M00387  SCF-FBW7 complex
Network
N00080  Loss of VHL to HIF-1 signaling pathway
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9978 (RBX1)
   04120 Ubiquitin mediated proteolysis
    9978 (RBX1)
  Replication and repair
   03420 Nucleotide excision repair
    9978 (RBX1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    9978 (RBX1)
   04350 TGF-beta signaling pathway
    9978 (RBX1)
   04066 HIF-1 signaling pathway
    9978 (RBX1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9978 (RBX1)
   04114 Oocyte meiosis
    9978 (RBX1)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    9978 (RBX1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9978 (RBX1)
   05211 Renal cell carcinoma
    9978 (RBX1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     9978 (RBX1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   9978 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     9978 (RBX1)
   ECV complex
     9978 (RBX1)
   Cul3 complex
     9978 (RBX1)
   Cul4 complex
     9978 (RBX1)
   Cul7 complex
     9978 (RBX1)
   Cul9 complex
     9978 (RBX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      9978 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      9978 (RBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 9978
NCBI-ProteinID: NP_055063
OMIM: 603814
HGNC: 9928
Ensembl: ENSG00000100387
Vega: OTTHUMG00000151298
Pharos: P62877(Tbio)
UniProt: P62877
Structure
PDB: 

Position
22q13.2
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcgtccgctacttcagaagagtgtactgtcgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag
tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system