KEGG   Homo sapiens (human): 998Help
Entry
998               CDS       T01001                                 

Gene name
CDC42, CDC42Hs, G25K, TKS
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04912  GnRH signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
Network
N00221  HTLV-I Tax to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    998 (CDC42)
   04015 Rap1 signaling pathway
    998 (CDC42)
   04010 MAPK signaling pathway
    998 (CDC42)
   04370 VEGF signaling pathway
    998 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    998 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    998 (CDC42)
   04520 Adherens junction
    998 (CDC42)
   04530 Tight junction
    998 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    998 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    998 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    998 (CDC42)
   04670 Leukocyte transendothelial migration
    998 (CDC42)
   04062 Chemokine signaling pathway
    998 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    998 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    998 (CDC42)
  09158 Development
   04360 Axon guidance
    998 (CDC42)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    998 (CDC42)
   05205 Proteoglycans in cancer
    998 (CDC42)
   05203 Viral carcinogenesis
    998 (CDC42)
   05212 Pancreatic cancer
    998 (CDC42)
   05211 Renal cell carcinoma
    998 (CDC42)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    998 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    998 (CDC42)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    998 (CDC42)
   05130 Pathogenic Escherichia coli infection
    998 (CDC42)
   05132 Salmonella infection
    998 (CDC42)
   05131 Shigellosis
    998 (CDC42)
   05100 Bacterial invasion of epithelial cells
    998 (CDC42)
   05165 Human papillomavirus infection
    998 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    998 (CDC42)
   03036 Chromosome and associated proteins [BR:hsa03036]
    998 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    998 (CDC42)
   04031 GTP-binding proteins [BR:hsa04031]
    998 (CDC42)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    998 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    998 (CDC42)
  Macropinocytosis
   Ras GTPases
    998 (CDC42)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    998 (CDC42)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   998 (CDC42)
  Exosomal proteins of breast milk
   998 (CDC42)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    998 (CDC42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 998
NCBI-ProteinID: NP_001034891
OMIM: 116952
HGNC: 1736
Ensembl: ENSG00000070831
Vega: OTTHUMG00000002753
Pharos: P60953(Tchem)
UniProt: P60953 A0A024RAE4
Structure
PDB: 

Position
1p36.12
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaacgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system