KEGG   Homo sapiens (human): 9984Help
Entry
9984              CDS       T01001                                 

Gene name
THOC1, HPR1, P84, P84N5
Definition
(RefSeq) THO complex 1
  KO
K12878  THO complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03040  Spliceosome
Module
hsa_M00405  THC complex
hsa_M00406  TREX complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9984 (THOC1)
  Translation
   03013 RNA transport
    9984 (THOC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     9984 (THOC1)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    9984 (THOC1)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    9984 (THOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: efThoc1 Death
Motif
Other DBs
NCBI-GeneID: 9984
NCBI-ProteinID: NP_005122
OMIM: 606930
HGNC: 19070
Ensembl: ENSG00000079134
Vega: OTTHUMG00000178051
Pharos: Q96FV9(Tbio)
UniProt: Q96FV9
Structure
PDB: 

Position
18p11.32
AA seq 657 aa AA seqDB search
MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILE
EEIINHSSCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNV
ATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQ
FNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
LQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAK
FLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSV
YQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPE
DFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMV
ENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEI
KTGEDEDEEDNDALLKENESPDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIR
QIECDSEDMKMRAKQLLVAWQDQEGVHATPENLINALNKSGLSDLAESLTNDNETNS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgacgccgccgctcttcagtttgcccgaagcgcggacgcggtttacgaagtct
accagagaggccttgaacaacaaaaacatcaagccattgttaagtaccttcagccaggta
cctggcagtgaaaatgaaaaaaaatgtacccttgaccaagctttcagaggtattctagaa
gaagaaattataaatcattcatcatgtgaaaacgttttagctattatttctcttgctatt
gggggagtaactgaaggtatttgtaccgcatctacaccttttgtattgttgggagatgtt
ttggattgtcttcctttggatcagtgtgacacaatattcacttttgtggaaaaaaatgtt
gctacttggaaatcaaatacattctattctgctgggaaaaattacttactacgtatgtgc
aatgatctcctaagaagattgtctaaatcccagaatacagtcttctgtggacggattcag
ctctttttggccaggcttttccctctgtctgagaaatcaggtcttaacttgcagagtcag
tttaatctggaaaatgtcactgttttcaatacaaatgagcaggaaagcaccctgggtcag
aagcacactgaagatagagaagaaggaatggatgtagaagaaggcgaaatgggagacgag
gaagctccaacaacgtgctctattccaattgattacaacctgtatcgaaaattctggtca
cttcaggattacttcaggaaccctgtgcaatgctatgagaagatttcatggaaaactttt
ctcaagtattctgaagaagttttagctgtttttaagagttataaattagatgatactcag
gcctcaagaaaaaagatggaagaattgaaaacaggaggagaacatgtatattttgcaaaa
tttttaacaagtgaaaagctgatggatttacaactgagtgacagtaactttcgtcgacac
atcctgttgcagtatctcattttattccaatatctcaaggggcaggtcaaattcaaaagt
tcaaactatgttttaactgatgagcaatcactttggattgaagatactacaaaatcagtt
tatcaactactatctgaaaacccccccgatggagaaagattttcaaagatggtagagcat
atattaaacactgaagaaaactggaactcgtggaaaaatgaaggttgcccaagttttgtg
aaagaaagaacatcagataccaaacctacgagaataattcggaagagaacagcacccgag
gacttcctagggaaaggacccaccaaaaaaattctgatgggaaatgaggagttaacaagg
ctttggaatctttgccctgataatatggaagcctgtaaatcagagacaagggaacacatg
cccactttggaggaattctttgaagaagccattgaacaggcagaccctgaaaatatggtg
gaaaatgaatataaggctgtgaacaattcaaattatggttggagagccctgagactatta
gcacggagaagccctcacttcttccagccaaccaaccagcagtttaaaagtttaccagaa
tatcttgaaaatatggtaataaagctagccaaggaattaccgcctccttctgaagaaata
aaaacaggtgaggatgaagatgaggaagataatgatgctctactgaaggaaaatgaaagt
cctgatgttcggcgagacaaacctgtaacaggagaacaaatagaggtatttgccaacaag
ctgggtgaacaatggaagattctggctccctacttggaaatgaaagactcagaaattagg
cagattgagtgtgacagtgaagacatgaagatgagagctaagcagctcctggttgcctgg
caagatcaagagggagttcatgcaacacctgagaatctgattaatgcactgaataagtct
ggattaagtgaccttgcagaaagtctaactaatgacaatgagacaaatagttag

DBGET integrated database retrieval system