KEGG   Homo sapiens (human): 999Help
Entry
999               CDS       T01001                                 

Gene name
CDH1, Arc-1, BCDS1, CD324, CDHE, ECAD, LCAM, UVO
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04520  Adherens junction
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
hsa05213  Endometrial cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05226  Gastric cancer
Network
N00061  CDH1-reduced expression to Wnt signaling pathway
N00257  Loss of CDH1 to Wnt signaling pathway
N00258  Mutation-inactivated CDH1 to Wnt signaling pathway
Disease
H00018  Gastric cancer
H00025  Penile cancer
H00032  Thyroid cancer
H00054  Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    999 (CDH1)
   04390 Hippo signaling pathway
    999 (CDH1)
   04371 Apelin signaling pathway
    999 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    999 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    999 (CDH1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    999 (CDH1)
  09162 Cancers: Specific types
   05226 Gastric cancer
    999 (CDH1)
   05216 Thyroid cancer
    999 (CDH1)
   05218 Melanoma
    999 (CDH1)
   05219 Bladder cancer
    999 (CDH1)
   05213 Endometrial cancer
    999 (CDH1)
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    999 (CDH1)
   05100 Bacterial invasion of epithelial cells
    999 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    999 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    999 (CDH1)
   04090 CD molecules [BR:hsa04090]
    999 (CDH1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    999 (CDH1)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   999 (CDH1)
CD molecules [BR:hsa04090]
 Proteins
  999 (CDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_3
Motif
Other DBs
NCBI-GeneID: 999
NCBI-ProteinID: NP_004351
OMIM: 192090
HGNC: 1748
Ensembl: ENSG00000039068
Vega: OTTHUMG00000137561
Pharos: P12830(Tbio)
UniProt: P12830 B3GN61 A0A0U2ZQU7
Structure
PDB: 

Position
16q22.1
AA seq 882 aa AA seqDB search
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgggcccttggagccgcagcctctcggcgctgctgctgctgctgcaggtctcctcttgg
ctctgccaggagccggagccctgccaccctggctttgacgccgagagctacacgttcacg
gtgccccggcgccacctggagagaggccgcgtcctgggcagagtgaattttgaagattgc
accggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcacagat
ggtgtgattacagtcaaaaggcctctacggtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtgggg
caccaccaccgccccccgccccatcaggcctccgtttctggaatccaagcagaattgctc
acatttcccaactcctctcctggcctcagaagacagaagagagactgggttattcctccc
atcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacaccc
cctgttggtgtctttattattgaaagagaaacaggatggctgaaggtgacagagcctctg
gatagagaacgcattgccacatacactctcttctctcacgctgtgtcatccaacgggaat
gcagttgaggatccaatggagattttgatcacggtaaccgatcagaatgacaacaagccc
gaattcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccaggaacctct
gtgatggaggtcacagccacagacgcggacgatgatgtgaacacctacaatgccgccatc
gcttacaccatcctcagccaagatcctgagctccctgacaaaaatatgttcaccattaac
aggaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctacg
tataccctggtggttcaagctgctgaccttcaaggtgaggggttaagcacaacagcaaca
gctgtgatcacagtcactgacaccaacgataatcctccgatcttcaatcccaccacgtac
aagggtcaggtgcctgagaacgaggctaacgtcgtaatcaccacactgaaagtgactgat
gctgatgcccccaataccccagcgtgggaggctgtatacaccatattgaatgatgatggt
ggacaatttgtcgtcaccacaaatccagtgaacaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtagcagtgacgaatgtggta
ccttttgaggtctctctcaccacctccacagccaccgtcaccgtggatgtgctggatgtg
aatgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcccaggagccagacacatttatggaacagaaa
ataacatatcggatttggagagacactgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggacagggaggattttgagcacgtgaagaacagcacg
tacacagccctaatcatagctacagacaatggttctccagttgctactggaacagggaca
cttctgctgatcctgtctgatgtgaatgacaacgcccccataccagaacctcgaactata
ttcttctgtgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatctcccttcacagcagaactaacacacggggcgagtgccaactggaccatt
cagtacaacgacccaacccaagaatctatcattttgaagccaaagatggccttagaggtg
ggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgaccacc
ttagaggtcagcgtgtgtgactgtgaaggggccgctggcgtctgtaggaaggcacagcct
gtcgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaaggaggc
ggagaagaggaccaggactttgacttgagccagctgcacaggggcctggacgctcggcct
gaagtgactcgtaacgacgttgcaccaaccctcatgagtgtcccccggtatcttccccgc
cctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaagcggctgatact
gaccccacagccccgccttatgattctctgctcgtgtttgactatgaaggaagcggttcc
gaagctgctagtctgagctccctgaactcctcagagtcagacaaagaccaggactatgac
tacttgaacgaatggggcaatcgcttcaagaagctggctgacatgtacggaggcggcgag
gacgactag

DBGET integrated database retrieval system