KEGG   Homo sapiens (human): 9991
Entry
9991              CDS       T01001                                 
Symbol
PTBP3, ROD1
Name
(RefSeq) polypyrimidine tract binding protein 3
  KO
K17844  polypyrimidine tract-binding protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9991 (PTBP3)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    9991 (PTBP3)
SSDB
Motif
Pfam: RRM_5 RRM_1 RRM_8 RRM_occluded
Other DBs
NCBI-GeneID: 9991
NCBI-ProteinID: NP_005147
OMIM: 607527
HGNC: 10253
Ensembl: ENSG00000119314
Pharos: O95758(Tbio)
UniProt: O95758 A0A024R163
Position
9:complement(112217715..112379882)
AA seq 552 aa
MDGVVTDLITVGLKRGSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRV
LHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPH
LRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSP
VLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAHYAKMALD
GQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFGAPGI
ISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGNSVL
LVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRL
YGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLS
NIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGEN
HHLRVSFSKSTI
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggatggtgttgttacagatcttataacagtcggtttaaagcggggatctgatgagctt
ctttcttctggcatcattaacggaccttttaccatgaatagttctactccttctacagct
aatgggaatgacagcaagaaatttaaacgagatagacctccctgttcgccttcccgtgtt
ctccatcttcgaaaaattccatgtgatgtcaccgaagcagagatcatatcattaggtcta
ccatttggcaaagtaactaatcttttgatgttgaaaggaaaaagccaggctttcttagaa
atggcttctgaggaagctgccgttactatggtgaattattacactcctattactcctcac
cttcgaagccagcctgtttatattcagtattccaatcacagagaacttaagactgacaat
ctacctaatcaagctcgagcccaagctgcactgcaggctgtcagtgccgtccaatcagga
agcctggccctttctggaggtccttccaatgaaggcacagtcctacctgggcagagccct
gtgcttcgaataattattgaaaacctcttttaccctgttaccctggaagttcttcatcag
atattttctaaatttggcacagtcttgaagattatcacctttacaaagaataatcagttt
caagccttgcttcagtatgctgacccagtaaatgcacattatgccaaaatggctctggat
ggccagaatatctataatgcatgctgcactctgcgcattgacttctccaagctcaccagc
cttaatgtgaaatataataatgacaaaagcagagacttcactcgcttagaccttcctact
ggtgatggccagccatcccttgaaccccctatggctgctgcttttggtgcaccgggtata
atttcttcaccatatgcaggggctgctggatttgccccagccattggatttcctcaagct
acaggtctatcagttccagctgttcctggagctcttggtcctctcacaatcacctcttct
gctgtcactggaaggatggccattcctggggctagtggtataccaggaaattctgttcta
ctcgtcacaaatctcaatcctgatcttatcacaccacatgggctttttatcctatttgga
gtctatggtgatgtacatcgagtgaagattatgtttaataagaaagaaaatgccttggtt
cagatggcggatgcaaatcaagctcagctagcaatgaaccatctaagtggtcagagactt
tatgggaaagtgcttcgtgctacactgtccaaacatcaagcagtacagcttcctcgagag
ggacaagaagaccaaggtctgactaaggatttcagcaatagtcctttgcatcgctttaaa
aagccgggctctaaaaacttccagaatatctttccaccatcagccactctgcatctttcc
aacattcccccttctgttacagtggatgatctgaagaaccttttcatagaagctggatgt
tcagtgaaggcttttaaattctttcagaaagatcgcaaaatggcgctcattcaattggga
tctgtggaagaagcaattcaggccctcattgagcttcataaccatgaccttggagaaaat
caccacctcagagtttccttctcaaaatctacaatctga

DBGET integrated database retrieval system