KEGG   Homo sapiens (human): 9992Help
Entry
9992              CDS       T01001                                 

Gene name
KCNE2, ATFB4, LQT5, LQT6, MIRP1
Definition
(RefSeq) potassium voltage-gated channel subfamily E regulatory subunit 2
  KO
K04896  potassium voltage-gated channel Isk-related subfamily E member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Disease
H00720  Long QT syndrome
H00731  Atrial fibrillation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    9992 (KCNE2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9992 (KCNE2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   9992 (KCNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ISK_Channel OSTbeta TMEM154
Motif
Other DBs
NCBI-GeneID: 9992
NCBI-ProteinID: NP_751951
OMIM: 603796
HGNC: 6242
Ensembl: ENSG00000159197
Vega: OTTHUMG00000086189
Pharos: Q9Y6J6(Tbio)
UniProt: Q9Y6J6
Structure
PDB: 

Position
21q22.11
AA seq 123 aa AA seqDB search
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMF
SFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFK
MSP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctactttatccaatttcacacagacgctggaagacgtcttccgaaggatttttatt
acttatatggacaattggcgccagaacacaacagctgagcaagaggccctccaagccaaa
gttgatgctgagaacttctactatgtcatcctgtacctcatggtgatgattggaatgttc
tctttcatcatcgtggccatcctggtgagcactgtgaaatccaagagacgggaacactcc
aatgacccctaccaccagtacattgtagaggactggcaggaaaagtacaagagccaaatc
ttgaatctagaagaatcgaaggccaccatccatgagaacattggtgcggctgggttcaaa
atgtccccctga

DBGET integrated database retrieval system