KEGG   Homo sapiens (human): 6046Help
Entry
6046              CDS       T01001                                 

Gene name
BRD2, BRD2-IT1, D6S113E, FSH, FSRG1, NAT, O27.1.1, RING3, RNF3
Definition
(RefSeq) bromodomain containing 2
  KO
K08871  bromodomain-containing protein 2
Organism
hsa  Homo sapiens (human)
Drug target
Apabetalone: D11131
Birabresib: D10911
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6046 (BRD2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6046 (BRD2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   6046 (BRD2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    6046 (BRD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET AF-4 DUF4667 Sigma70_ner IMUP Utp14
Motif
Other DBs
NCBI-GeneID: 6046
NCBI-ProteinID: NP_001106653
OMIM: 601540
HGNC: 1103
Ensembl: ENSG00000204256
Vega: OTTHUMG00000031241
Pharos: P25440(Tchem)
UniProt: P25440 A0A024RCR5
Structure
PDB: 

Position
6p21.32
AA seq 801 aa AA seqDB search
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM
PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI
PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
SSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG
PISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL
GPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE
KLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKP
VGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS
SDSSSSSSSSSSSDTSDSDSG
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaaacgtgactccccacaataagctccctggggaagggaatgcagggttgctg
gggctgggcccagaagcagcagcaccagggaagaggattcgaaaaccctctctcttgtat
gagggctttgagagccccacaatggcttcggtgcctgctttgcaacttacccctgccaac
ccaccacccccggaggtgtccaatcccaaaaagccaggacgagttaccaaccagctgcaa
tacctacacaaggtagtgatgaaggctctgtggaaacatcagttcgcatggccattccgg
cagcctgtggatgctgtcaaactgggtctaccggattatcacaaaattataaaacagcct
atggacatgggtactattaagaggagacttgaaaacaattattattgggctgcttcagag
tgtatgcaagattttaataccatgttcaccaactgttacatttacaacaagcccactgat
gatattgtcctaatggcacaaacgctggaaaagatattcctacagaaggttgcatcaatg
ccacaagaagaacaagagctggtagtgaccatccctaagaacagccacaagaagggggcc
aagttggcagcgctccagggcagtgttaccagtgcccatcaggtgcctgccgtctcttct
gtgtcacacacagccctgtatactcctccacctgagatacctaccactgtcctcaacatt
ccccacccatcagtcatttcctctccacttctcaagtccttgcactctgctggacccccg
ctccttgctgttactgcagctcctccagcccagccccttgccaagaaaaaaggcgtaaag
cggaaagcagatactaccacccctacacctacagccatcttggctcctggttctccagct
agccctcctgggagtcttgagcctaaggcagcacggcttccccctatgcgtagagagagt
ggtcgccccatcaagcccccacgcaaagacttgcctgactctcagcaacaacaccagagc
tctaagaaaggaaagctttcagaacagttaaaacattgcaatggcattttgaaggagtta
ctctctaagaagcatgctgcctatgcttggcctttctataaaccagtggatgcttctgca
cttggcctgcatgactaccatgacatcattaagcaccccatggacctcagcactgtcaag
cggaagatggagaaccgtgattaccgggatgcacaggagtttgctgctgatgtacggctt
atgttctccaactgctataagtacaatcccccagatcacgatgttgtggcaatggcacga
aagctacaggatgtatttgagttccgttatgccaagatgccagatgaaccactagaacca
gggcctttaccagtctctactgccatgccccctggcttggccaaatcgtcttcagagtcc
tccagtgaggaaagtagcagtgagagctcctctgaggaagaggaggaggaagatgaggag
gacgaggaggaagaagagagtgaaagctcagactcagaggaagaaagggctcatcgctta
gcagaactacaggaacagcttcgggcagtacatgaacaactggctgctctgtcccagggt
ccaatatccaagcccaagaggaaaagagagaaaaaagagaaaaagaagaaacggaaggca
gagaagcatcgaggccgagctggggccgatgaagatgacaaggggcctagggcaccccgc
ccacctcaacctaagaagtccaagaaagcaagtggcagtgggggtggcagtgctgcttta
ggcccttctggctttggaccttctggaggaagtggcaccaagctccccaaaaaggccaca
aagacagccccacctgccctgcctacaggttatgattcagaggaggaggaagagagcagg
cccatgagttacgatgagaagcggcagctgagcctggacatcaacaaattacctggggag
aagctgggccgagttgtgcatataatccaagccagggagccctctttacgtgattcaaac
ccagaagagattgagattgattttgaaacactcaagccatccacacttagagagcttgag
cgctatgtcctttcctgcctacgtaagaaaccccggaagccctacaccattaagaagcct
gtgggaaagacaaaggaggaactggctttggagaaaaagcgggaattagaaaagcggtta
caagatgtcagcggacagctcaattctactaaaaagccccccaagaaagcgaatgagaaa
acagagtcatcctctgcacagcaagtagcagtgtcacgccttagcgcttccagctccagc
tcagattccagctcctcctcttcctcgtcgtcgtcttcagacaccagtgattcagactca
ggctaa

DBGET integrated database retrieval system