KEGG   Homo sapiens (human): 3012Help
Entry
3012              CDS       T01001                                 

Gene name
HIST1H2AE, H2A.1, H2A.2, H2A/a, H2AFA
Definition
(RefSeq) histone cluster 1 H2A family member e
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3012 (HIST1H2AE)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    3012 (HIST1H2AE)
  09165 Substance dependence
   05034 Alcoholism
    3012 (HIST1H2AE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3012 (HIST1H2AE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3012 (HIST1H2AE)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    3012 (HIST1H2AE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3012 (HIST1H2AE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 3012
NCBI-ProteinID: NP_066390
OMIM: 602786
HGNC: 4724
Ensembl: ENSG00000277075
Vega: OTTHUMG00000014440
UniProt: P04908 Q08AJ9
Structure
PDB: 

Position
6p22.2
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggaaagcaaggcggcaaagctcgggcaaaagctaaaacgcgttcttcc
agggccggtcttcagtttccagttggccgtgtgcaccgcctcctccgcaaaggcaactac
tccgaacgagtcggggccggcgctccagtgtacctggcagcggtgctggaatatctgacg
gccgagatcttagagctagctggcaacgcggctcgcgacaataagaagacccgcatcatc
ccgcgccacctgcagctagccatccgcaacgacgaggagctaaataagcttctaggtcgc
gtgaccatcgcgcagggcggtgtcctgcccaacatccaggccgtattgctgcctaagaag
acggagagccaccataaggccaagggcaagtga

DBGET integrated database retrieval system