KEGG   Homo sapiens (human): 3012Help
Entry
3012              CDS       T01001                                 

Gene name
HIST1H2AE, H2A.1, H2A.2, H2A/a, H2AFA
Definition
(RefSeq) histone cluster 1 H2A family member e
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3012 (HIST1H2AE)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    3012 (HIST1H2AE)
  Substance dependence
   05034 Alcoholism
    3012 (HIST1H2AE)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    3012 (HIST1H2AE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3012 (HIST1H2AE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3012
NCBI-ProteinID: NP_066390
OMIM: 602786
HGNC: 4724
Ensembl: ENSG00000277075
Vega: OTTHUMG00000014440
UniProt: P04908 Q08AJ9
Structure
PDB: 

Position
6p22.2
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggaaagcaaggcggcaaagctcgggcaaaagctaaaacgcgttcttcc
agggccggtcttcagtttccagttggccgtgtgcaccgcctcctccgcaaaggcaactac
tccgaacgagtcggggccggcgctccagtgtacctggcagcggtgctggaatatctgacg
gccgagatcttagagctagctggcaacgcggctcgcgacaataagaagacccgcatcatc
ccgcgccacctgcagctagccatccgcaacgacgaggagctaaataagcttctaggtcgc
gtgaccatcgcgcagggcggtgtcctgcccaacatccaggccgtattgctgcctaagaag
acggagagccaccataaggccaagggcaagtga

DBGET integrated database retrieval system