KEGG   Homo sapiens (human): 115939Help
Entry
115939            CDS       T01001                                 

Gene name
TSR3, C16orf42
Definition
(RefSeq) TSR3, acp transferase ribosome maturation factor
  KO
K09140  pre-rRNA-processing protein TSR3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    115939 (TSR3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    115939 (TSR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribo_biogen_C RLI
Motif
Other DBs
NCBI-GeneID: 115939
NCBI-ProteinID: NP_001001410
OMIM: 617058
HGNC: 14175
Ensembl: ENSG00000007520
Vega: OTTHUMG00000047834
Pharos: Q9UJK0(Tdark)
UniProt: Q9UJK0
Position
16p13.3
AA seq 312 aa AA seqDB search
MGRRRAARGPGAEGGRPRHLPTRSLEAFAEEVGAALQASVEPGAADGEGGPGPAALPCTL
AMWELGHCDPRRCTGRKLARLGLVRCLRLGHRFGGLVLSPVGKQYASPADRQLVAQSGVA
VIDCSWARLDETPFGKMRGSHLRLLPYLVAANPVNYGRPYRLSCVEAFAATFCIVGFPDL
AVILLRKFKWGKGFLDLNRQLLDKYAACGSPEEVLQAEQEFLANAKESPQEEEIDPFDVD
SGREFGNPNRPVASTRLPSDTDDSDASEDPGPGAERGGASSSCCEEEQTQGRGAEARAPA
EVWKGIKKRQRD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaggagggcagcgcgcgggccgggggcggaaggcggccgccctcggcacctc
ccgacgcgctccctggaggccttcgccgaggaggtcggcgccgcgctgcaggcttccgtg
gagccaggggcggctgacggcgagggcggcccgggcccggcggcgctgccctgcacgctg
gccatgtgggagttgggccactgcgacccccggcgctgcacgggccgcaagctggcccgc
ctggggctggtgcgctgcctgcgcctgggccacagattcggcggtctggtgctgagcccc
gtgggcaagcagtacgcgtcccccgcagacagacagctggtggcgcagtctggggtcgcc
gtcatcgactgctcctgggccaggctggacgagacaccgtttgggaagatgcgagggagc
cacttgcgcctgttgccctacctggtggccgccaaccccgtgaactatggccggccctac
agactttcctgcgtggaagcgtttgctgccaccttctgcatcgtaggctttccagacctt
gctgtcattttgctgcggaagtttaaatggggcaagggcttcttggacctgaaccgccag
ctcctggacaagtacgcggcctgcggcagcccggaggaggtgctgcaggcggagcaggag
ttcttggccaatgccaaggagagcccccaggaggaggagatcgatcccttcgatgtggat
tcagggagagagtttggaaaccccaacaggcctgtggccagcacccggctgccctcggac
actgatgacagtgatgcgtctgaggacccagggcctggcgccgagcgcggaggagccagc
agcagctgctgtgaagaggagcagacgcagggacggggggctgaggccagggccccggct
gaggtttggaaaggaatcaagaaacggcagagagactga

DBGET integrated database retrieval system