KEGG   Hungateiclostridium saccincola: HVS_08280Help
Entry
HVS_08280         CDS       T05223                                 

Definition
(GenBank) Methylmalonyl-CoA carboxyltransferase 5S subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
hsc  Hungateiclostridium saccincola
Pathway
hsc00620  Pyruvate metabolism
hsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HVS_08280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsc02000]
    HVS_08280
Enzymes [BR:hsc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     HVS_08280
Transporters [BR:hsc02000]
 Other transporters
  Primary active transporters [TC:3]
   HVS_08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: AUG57564
UniProt: A0A2K9EBM0
Position
complement(1836402..1837793)
Genome map
AA seq 463 aa AA seqDB search
MAKITETVLRDAHQSLIATRMKIDEMAPILEKLDDIGYHSLEAWGGATFDSCLRFLNEDP
WERLRTIRKHVKKTKLQMLLRGQNLLGYKHYADDVVEYFVQKAIANGIDIIRIFDALNDV
RNIETAIKACKKEGGHAQAAVCYTTSPVHNLDLFVKDAKRLVDMGADSICIKDMAGLMLP
YAAYDLVKALKENVKVPIQIHTHYTSGVASMTYLKAIEAGCDVVDCAISPLALGTSQPPT
ESVVATLKGTEYDTGLDINKLNEIAEYFKPLREEYLNSGLLDAKVLGVDINTLIYQVPGG
MLSNLVSQLKQSNALDKFEEVLKEIPKVREDFGFPPLVTPTSQIVGTQAVLNVLMGERYK
MVPKESKALVKGEYGKTPAPVNPEIQKKILNGEKPITKRPADFIKPELKNIKNEMKEYLE
QDEDVLSYALFPSVAKKYFEFRKAEKYGIDPDMVDYENRVHPV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaataactgaaactgttctaagggatgcccatcaatcactaattgccacacgc
atgaaaattgatgaaatggctcctatattagaaaagcttgatgatatagggtatcattca
ctggaagcttggggaggggcaacatttgactcttgcttaagatttttaaatgaagatcct
tgggaaagattaaggacaattagaaaacatgttaagaaaacaaagcttcaaatgctttta
agaggtcagaaccttttaggttataagcattatgcagatgatgtagtagaatattttgtc
caaaaggcaatagcaaacggaattgacataataagaatttttgatgctttaaatgatgta
agaaatattgaaactgccattaaagcatgtaaaaaagaaggagggcatgcacaagctgct
gtatgctataccacaagcccggttcacaatttagacctttttgtaaaagatgcaaagaga
cttgtggacatgggggcagactctatatgcataaaggatatggcaggtttaatgcttcct
tatgcagcatatgacttggtaaaagcactgaaggaaaatgtaaaagtacctatacaaatt
cacacccactatacaagcggtgttgcatcaatgacatatctaaaggctatagaagcagga
tgtgacgtggtggactgtgcaatatcacctttagctcttggaacttcacagccacctaca
gaatcagttgttgcaactttaaaaggtactgaatacgacacaggtcttgacataaacaaa
ttaaatgaaattgcagagtatttcaaacctttaagagaggaatacctaaacagcgggctt
ttagatgcaaaagtgctgggagttgatattaatacattaatataccaggttcccggtgga
atgctttcaaaccttgtatcacaacttaagcaatcaaatgcccttgataaatttgaagaa
gttttaaaagaaataccaaaggtaagggaagactttggttttcctcctctggtaactcct
acaagccagattgtaggtacacaggctgttttgaatgtattgatgggtgagagatataag
atggttccaaaggaatcaaaggcgctggtaaaaggagagtatggcaaaacaccggcacct
gttaatcctgaaatacaaaagaaaattttaaacggtgaaaaacctattactaaaagacct
gctgactttataaagcctgagcttaaaaatataaaaaatgaaatgaaagagtatttagaa
caggatgaagatgtgctgtcttatgcactattcccatccgttgcaaaaaaatattttgag
ttcaggaaagcagagaaatacgggatagaccctgatatggtggattatgaaaacagggta
cacccagtgtaa

DBGET integrated database retrieval system