KEGG   Hungateiclostridium saccincola: HVS_15660Help
Entry
HVS_15660         CDS       T05223                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hsc  Hungateiclostridium saccincola
Pathway
hsc00030  Pentose phosphate pathway
hsc00480  Glutathione metabolism
hsc01100  Metabolic pathways
hsc01110  Biosynthesis of secondary metabolites
hsc01120  Microbial metabolism in diverse environments
hsc01130  Biosynthesis of antibiotics
hsc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HVS_15660 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HVS_15660 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsc04147]
    HVS_15660 (zwf)
Enzymes [BR:hsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     HVS_15660 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     HVS_15660 (zwf)
Exosome [BR:hsc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   HVS_15660 (zwf)
  Exosomal proteins of colorectal cancer cells
   HVS_15660 (zwf)
  Exosomal proteins of bladder cancer cells
   HVS_15660 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AUG58972
UniProt: A0A2K9E5G8
Position
complement(3437831..3439309)
Genome map
AA seq 492 aa AA seqDB search
MKSGFYHNTPLAFAIFGGTGDLTKRKLIPALFSLVKEKRISDEISIVLVGRRNKDVIEFK
EELLEFVKAYSRHKVKKDDWEAFAEKINYCRFDFEDEERGYNDLAKILENCHDRIFYLAV
APGLFEIIIKNLKKYNLIERDTGFQRIMIEKPFGFSLESAGKLNAAITKIIPEKKIFRVD
HYLGKEMIQNILSIRFGNSIFEPLWNHHYIDNIQIISTETIGVENRGGYYDSTGVVKDML
QNHILQMLALIAMEPPVDLEPESIRNEKVKVLKSLRLFDKESAQKNIVRGQYGRGIIGGV
EVPAYREEERVSENSNTDTFIALKINVDNFRWAGVPFYVKTGKRLDKKTTRIIVQFKKLP
GINFYKNLNNGKPNLLVIKIQPEEGVFFQINAKSPGIDLIEPVKADYCHSCRADYNSPEA
YEQIILEAIRNNSSIFTRWDELECSWKFEKSISESFEGIEPNFPNYAAGSKGPVEAAELL
ERDGRIWWDTFI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtggattttatcataatactccgctggcttttgctatatttggcgggacaggt
gatttaaccaaaagaaagcttattccggctctgttttcccttgtaaaagaaaaaagaatt
tcagatgaaatttccattgttttggtagggagaagaaataaagatgtaatagaatttaaa
gaagaacttttggagtttgtaaaagcttattcaaggcataaagtaaaaaaggatgactgg
gaagcatttgctgaaaaaattaattactgcaggtttgatttcgaagatgaagaaagagga
tacaatgatttggctaaaattttagaaaactgccacgacaggattttttatctggcagtg
gcacccgggctttttgaaattatcattaaaaaccttaaaaaatacaatcttattgaaagg
gatacgggttttcagagaattatgattgaaaaaccctttggttttagtcttgaaagcgcc
ggaaagctaaatgcggccataacaaaaataattcctgagaaaaagatattcagggtagac
cactaccttggaaaagaaatgatacaaaatattctttctataagatttggcaattccatt
tttgagcctttgtggaatcaccattatattgacaatatccagattatatcaactgaaaca
ataggtgtggaaaacaggggtgggtattatgacagcacaggagttgttaaagacatgctt
caaaaccacattcttcaaatgcttgcccttatagctatggagccccctgtggatttggag
ccggaatccataagaaacgaaaaagttaaggtgttaaaatcattaagattatttgacaaa
gaaagtgcacaaaagaatattgttagggggcagtatggaagaggaattataggtggtgtg
gaagttccggcatatagggaagaggagagggtttctgaaaattcaaatacagacacattt
attgcccttaaaataaatgtggataatttcaggtgggcaggggtgccgttttatgttaag
acgggaaaaagacttgataaaaaaacaacccggataattgtccagtttaaaaagcttccc
gggataaatttttataaaaatttaaataatgggaaacctaaccttttggtgataaaaatt
cagccggaggaaggtgtgttttttcagataaatgcaaaaagcccgggaattgacttaata
gaacctgtaaaagcggattactgtcattcctgcagagcggattataattccccggaagcc
tatgaacaaattatactggaggcaataagaaataactcctctatttttaccaggtgggat
gaattggaatgttcctggaagtttgaaaagagcattagtgaatcctttgagggaatagag
cctaactttccaaactatgcggcaggttctaaaggtcctgtggaagctgcagagctttta
gaaagggatggcagaatatggtgggacacttttatttaa

DBGET integrated database retrieval system