KEGG   Herbinix luporum: SD1D_1114Help
Entry
SD1D_1114         CDS       T04072                                 

Gene name
pycB
Definition
(GenBank) Pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
hsd  Herbinix luporum
Pathway
hsd00620  Pyruvate metabolism
hsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SD1D_1114 (pycB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsd02000]
    SD1D_1114 (pycB)
Enzymes [BR:hsd01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SD1D_1114 (pycB)
Transporters [BR:hsd02000]
 Other transporters
  Primary active transporters [TC:3]
   SD1D_1114 (pycB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Vinculin
Motif
Other DBs
NCBI-ProteinID: CUH92660
UniProt: A0A0K8J5C4
Position
I:1204827..1206239
Genome map
AA seq 470 aa AA seqDB search
MAKQAKRPVKITETILRDAHQSLIATRMSTEEMLPVIEKMDKVGYHSVECWGGATFDASL
RFLKEDPWDRLRKIRAGFKNTKLQMLFRGQNILGYRHYADDVVEYFVQKSIANGIDIIRI
FDALNDMRNLESTVKATNKENGHAQIAICYTLGDAYTIDYYVKLAKDIESLGASSICIKD
MAGLLVPYQATELVTALKKAVKIPINLHTHYTSGVASMTYMKAVEAGCDIIDTAMSPFAL
GTSQPATEVMVETFKGTPYDTGYDQKLLAEIADYFRPIKDKALEKGLLNPKVMGVDIKTL
LYQVPGGMLSNLVSQLKEQKAEDKYYEVLEEVPRVRKDFGEPPLVTPSSQIVGTQAVLNV
LTGERYKMVTKESRALLSGEYGRTAKPFNKEVQKKVIGDKKPITCRPADLLEPELKKIEA
EIAEWKEQDEDVLSYALFPQVAMEYFKYRQAQKTGVDVTEGDSENKAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaagcaaaaagaccggttaaaattacggagactattcttcgtgacgcacat
caatctttgatagccacaagaatgtccaccgaagagatgctgccggtaattgaaaaaatg
gataaagtaggctaccattccgttgaatgttggggtggagctacctttgatgcttcctta
cgttttcttaaggaagatccatgggatagattaagaaaaataagagcaggatttaaaaac
actaaactacaaatgcttttccgtggtcagaacatcttaggatatcgtcattatgcagat
gatgttgtagaatactttgttcaaaaatccattgcaaacggtatcgatatcatccgtata
tttgacgccctaaatgatatgcgaaaccttgaatccacagtaaaagctaccaacaaggaa
aatggccatgctcagattgctatatgctataccctaggagatgcatataccatagattat
tatgtaaaattagctaaggatatagaatctttaggtgcctcatccatatgtattaaggat
atggccggactattggttccttatcaagctaccgaattggtaacagctcttaaaaaggcc
gtaaaaattcctattaatcttcatacccactataccagtggtgtggcatctatgacatat
atgaaagcagtagaggccggttgtgatattatagacactgctatgtcaccttttgcactg
ggtaccagccaacctgctacagaagttatggtagaaactttcaaaggtactccatatgat
accggctatgatcagaagctcctggcagagattgcggactatttccgtcctatcaaggat
aaggcattagaaaaaggtttacttaaccctaaggtaatgggtgttgatatcaaaacttta
ctataccaagtaccaggcggaatgttatccaatctggtatctcagcttaaggagcaaaaa
gcagaagataaatactatgaagttcttgaggaagttcccagagtccgtaaggattttggt
gaaccgccactggttacaccttcaagccaaattgtaggaacccaggccgtattaaatgta
ctgacaggggaacgctataagatggtaacaaaggaatctagggctcttttatccggtgaa
tatggtagaactgcaaaaccctttaataaagaggttcagaaaaaggttatcggtgataaa
aagcctataacttgcagaccggctgatttacttgagcctgagcttaaaaaaattgaggct
gaaattgccgaatggaaagagcaggatgaggatgtattatcctatgctttattccctcag
gttgctatggaatatttcaaataccgtcaggcacaaaagacaggtgttgatgtaacagag
ggcgatagcgagaataaagcttatcctgtataa

DBGET integrated database retrieval system