KEGG   Herbinix luporum: SD1D_1725Help
Entry
SD1D_1725         CDS       T04072                                 

Definition
(GenBank) hypothetical protein
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
hsd  Herbinix luporum
Pathway
hsd00900  Terpenoid backbone biosynthesis
hsd01100  Metabolic pathways
hsd01110  Biosynthesis of secondary metabolites
hsd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SD1D_1725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsd01006]
    SD1D_1725
Enzymes [BR:hsd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SD1D_1725
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SD1D_1725
    2.5.1.29  geranylgeranyl diphosphate synthase
     SD1D_1725
Prenyltransferases [BR:hsd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SD1D_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Gal4_dimer
Motif
Other DBs
NCBI-ProteinID: CUH93270
UniProt: A0A0K8J6Y4
Position
I:complement(1849166..1850080)
Genome map
AA seq 304 aa AA seqDB search
MNFNIELEKRLSEIEEILKDYLPKEEGYYKKLMEAMNYSILAGGKRIRPMLMLETFRLFE
GRDINILHPFMAAIEMIHTYSLVHDDLPAMDNDEYRRGRKTTHIVYGEAMAILAGDGLLT
LAFETAAKAFNMVDDTLEEAHIIYKRIIRALQILSSKAGIHGMIGGQVIDIESEGHPISK
DRLDIMYLLKTGALIEASMMIGGVIAGAGDDEIRTIESIASDIGLAFQIRDDILDVTGDD
KILGKPVHSDEKNDKSTYIAIMDIEQAIKEVSSVTDRARKAYESLPYKNEYLESLIIKLM
NRDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaatattgagttagaaaaacgcttatctgagattgaagaaatactaaaagac
tatttgcctaaggaagaaggctattataaaaaattaatggaagccatgaattatagcatc
ttagccggaggtaagcggattcggcctatgcttatgttggaaaccttccggctttttgaa
ggtagggatataaatattttacatccctttatggctgcaatcgaaatgattcatacttat
tccttagtccatgatgatcttccggctatggataatgatgaatatcgcaggggaagaaag
actacccatattgtatacggagaagccatggctattcttgcaggagacggacttttaacc
cttgcctttgaaacagcagctaaagcctttaacatggttgatgatactttagaggaagcc
catattatatataaaagaataataagagcacttcaaatcttatcaagtaaagccggaatt
catggaatgatcggaggacaggttattgatatagaatctgaggggcatcctataagcaag
gataggcttgatataatgtaccttttaaagaccggagctttgattgaagcttcaatgatg
ataggtggggtaattgcaggggccggggatgatgagattcgtactatagaaagtatcgcc
tcagatatcggactggcatttcaaataagggatgatatcctagatgttaccggggatgat
aaaatacttggaaagcctgttcatagcgatgaaaaaaatgataaatccacttatatagcc
attatggatatagagcaggcaataaaagaagtaagctctgttacagatagggcaaggaag
gcctatgaatctttgccttacaagaatgaatatttggaatctttaattattaaattaatg
aacagagataagtag

DBGET integrated database retrieval system