KEGG   Herbinix luporum: SD1D_2337Help
Entry
SD1D_2337         CDS       T04072                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
hsd  Herbinix luporum
Pathway
hsd00471  D-Glutamine and D-glutamate metabolism
hsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SD1D_2337 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hsd01011]
    SD1D_2337 (murI)
Enzymes [BR:hsd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SD1D_2337 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:hsd01011]
 Precursor biosynthesis
  Racemase
   SD1D_2337 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DHDPS DUF5429 DUF3865
Motif
Other DBs
NCBI-ProteinID: CUH93849
UniProt: A0A0K8J8N7
Position
I:complement(2517430..2518239)
Genome map
AA seq 269 aa AA seqDB search
MTKAPIGVFDSGVGGLTVVKEIMNQIPGETIIYFGDTARLPYGSKSKKTIITYTRQIVRF
LMRKGVKAIVIACNTASAFALETIKDEIDIPIIGVVKPGAKVAARTTLNGKVGVIGTEGT
IQSGIYNRFLSKTNPKVTVFGKACPLFVPLVEEGLIDDPITFEMARRYIGELLDKDIDTL
VLGCTHYPLLRETIRKVVGDEIFLVNPAYETAKCLAAVLTEHNLRNDTTQALNHKFYVSD
GAEKFKRFANTILPCEVMETKDINIEELG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcaccgattggggtatttgattcaggagtaggaggattgactgttgtaaaa
gaaatcatgaatcagatacccggagaaaccataatatattttggagatacagccaggctt
ccctatggaagtaagtctaaaaaaacaattattacttatactaggcagattgtaagattt
ttaatgagaaaaggggtaaaggccattgtaattgcttgtaatacggccagtgcatttgcc
ctagagactattaaagatgaaattgacatacctattatcggggtagtaaaacccggggcc
aaagtggcagcaagaaccaccttaaatggaaaagtaggtgtaattggtactgaaggaact
atacaaagcggaatatataacaggtttttaagcaaaacaaatcctaaggtaactgtattt
ggtaaagcatgcccgctttttgtacctttagtggaagaaggattaattgatgatcctatt
acctttgaaatggcaagaagatatataggagaacttttagataaggatatagatacattg
gtattaggttgtacccattatcctttgcttagggaaaccataagaaaggttgtaggagac
gaaatctttttagttaatcctgcatacgaaacagccaaatgtcttgcggcagtcctaaca
gagcataacttaagaaatgatactactcaagcccttaatcataaattctatgtcagtgac
ggagccgaaaaattcaaacgttttgctaataccattttaccctgtgaggtaatggaaact
aaggacataaatattgaagaactgggttga

DBGET integrated database retrieval system