KEGG   Herbaspirillum seropedicae SmR1: Hsero_0472Help
Entry
Hsero_0472        CDS       T01268                                 

Gene name
cpsG
Definition
(GenBank) phosphomannomutase protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse00030  Pentose phosphate pathway
hse00051  Fructose and mannose metabolism
hse00052  Galactose metabolism
hse00230  Purine metabolism
hse00500  Starch and sucrose metabolism
hse00520  Amino sugar and nucleotide sugar metabolism
hse00521  Streptomycin biosynthesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_0472 (cpsG)
   00030 Pentose phosphate pathway
    Hsero_0472 (cpsG)
   00051 Fructose and mannose metabolism
    Hsero_0472 (cpsG)
   00052 Galactose metabolism
    Hsero_0472 (cpsG)
   00500 Starch and sucrose metabolism
    Hsero_0472 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    Hsero_0472 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    Hsero_0472 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hsero_0472 (cpsG)
Enzymes [BR:hse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hsero_0472 (cpsG)
    5.4.2.8  phosphomannomutase
     Hsero_0472 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADJ61997
UniProt: D8IXC2
Position
513348..514724
Genome map
AA seq 458 aa AA seqDB search
MTSLSPSIFKAYDIRGIIGKTLDGTVAYRIGQAFGAAALAKGQKKVVIGRDGRLSGPELA
AELARGLQAVGVDVIDLGMVATPMVYFGTHVLDTQSGIMVTGSHNPPDYNGFKMVLAGEA
IHGETIQALYHAIVKGDFPQGAGGYATHDIKAAYIERMLADVKLARPLKIAVDCGNGVAG
AFAGEIYRTLGCEVTELFCEVDGTFPNHHPDPAHPENLQDLIRCLRETDCELGLAFDGDG
DRLGLVTKDGQIIYPDRQLMLFAEDVLTRHPGKEILYDVKCTRHLAPWITARGGRPLMWK
TGHSLVKAKLRETGAPLGGEMSGHIFFKDRWFGFDDGLYAGVRMLELMARQADPSAVLNA
LPQSVSTPELQLKLQEGENVALIGKLQGEASFEGAQEIIAIDGLRVEYPDGFGLARSSNT
TPVVVLRFEAETPEALARIQAQFRQAILAVRPEVALPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcactttcaccctccatcttcaaggcttacgacatccgcggcatcatcggcaag
acgctcgatggcacggtagcgtatcgcatcggccaggcctttggcgccgccgccctggcc
aagggacagaagaaggtcgtgatcggtcgcgatggtcgtctctccgggcctgaactggct
gccgaactggctcgcggcctgcaggcggtgggcgtggatgtgatcgacctgggcatggtg
gccactcccatggtctacttcggcacccatgtgctggacacccagtcgggcatcatggtc
accggcagccacaatccgccggactataacggtttcaagatggtgctggccggcgaggcc
atccacggcgagaccatccaggcgctctaccacgccatcgtcaagggcgacttcccgcag
ggcgcgggcggctacgccactcatgacatcaaggccgcctatatcgagcgcatgctcgcc
gacgtcaagctggcgcgtccgctgaagatcgccgtggattgcggcaatggcgtggccggc
gcatttgctggcgagatctaccggacgctgggctgcgaggtgaccgagctgttctgcgaa
gtcgacggcaccttccccaatcatcatcccgatccggcccatccggaaaacctgcaagac
ctgatccgctgcctgcgcgagaccgactgcgaactcggcctggccttcgatggtgacggc
gaccgcctgggcctggtgaccaaggatggccagatcatctatccggaccgccagctcatg
ctcttcgccgaagacgtgctgacccgccatccgggcaaggaaatcctctacgacgtcaaa
tgcacccgccacctggcgccctggatcactgcgcgcggcggccggccgctgatgtggaag
accgggcattcgctggtcaaggccaagctgcgcgagaccggcgccccgctgggcggcgag
atgagcggccatatcttcttcaaggaccgctggttcggtttcgatgatggtctctatgcc
ggcgtacgcatgctggagctgatggcgcgccaggctgatccgtcggcagtgctcaatgcc
ttgccgcagtcggtgagcacgcctgaattgcagctcaagctgcaggaaggcgagaacgtg
gcgctcatcggcaaactgcagggcgaagccagtttcgaaggcgcccaggagatcatcgcc
atcgatggcctgcgcgtggaatatccggacggtttcggtctggcgcgctcgtccaacacc
acgccggtggtggtgttgcgcttcgaggcggaaacccccgaggcgctggcgcgcatccag
gcgcagttccgccaggccatcctggcggtgcggccagaggtggcattgccgttctga

DBGET integrated database retrieval system